NOMV-ANTIGEN CONJUGATES AND THEIR USE

专利摘要:
The technology provided is in the field of conjugation of non-detergent-derived native outer membrane vesicles (nOMV) which are particularly useful for immunogenic compositions and immunization; methods for the preparation and use of such conjugates are also provided.
公开号:BE1025443B1
申请号:E2017/5856
申请日:2017-11-23
公开日:2019-02-28
发明作者:Benedetto Roberta Di；Francesca Micoli；Allan James Saul
申请人:Glaxosmithkline Biologicals Sa；
IPC主号:

专利说明:

NOMV-ΆΝΤΙGENE CONJUGATES AND THEIR USE
Technical area
This invention is in the field of conjugation of “native” external membrane vesicles (nOMV), not extracted by a detergent, with antigens, to form nOMV-antigen conjugates, which are particularly useful for immunization.
1 ¹ art background
Conjugation of antigens to carriers is an established procedure to improve immunogenicity, especially for polysaccharides. For example, bacterial capsular polysaccharides (PSCs) are antigens naturally independent of T cells that give rise to an immune response that lacks several important properties. Conjugation to a carrier converts these saccharides into T-cell dependent antigens which can then produce an immunological memory effect, and also trigger effective immune responses in young children.
A known carrier in such conjugates is the OMPC outer membrane protein complex, formed from vesicles of N. meningitidis (for example, see EP-0467714), which has been included as a carrier in approved vaccines based on conjugates of H. influenzae B. L ¹ OMPC has also been used as a support in protein conjugates. For example, Wu et al. (PNAS USA 2006; 103 (48): 18243-18248) report that the conjugation of Pfs25H with OMPC has resulted in a
BE2017 / 5856 vaccine based on Pfs25H-OMPC conjugate which was> 1000 times more potent in producing anti-Pfs25H reactivity by the ELISA technique in mice than a similar dose of Pfs25H alone.
Conjugation of 1OMPC to the protein Pfs25H can be obtained by reacting the Pfs25H activated by a maleimide with thiolated outer membrane proteins within 1 ¹ OMPC (see, for example, document WO 2006/124712), as it is shown in diagram 1.
Pfs25H
As shown in diagram 1 above and according to general procedures of the prior art, the conjugation methods and their conjugates envisage the use of a bivalent heterobifunctional linker, that is to say, a group linker having the terminal ends carrying functional groups
BE2017 / 5856 different. This is mainly to avoid crosslinking of the vesicle-linker intermediate with another vesicle particle rather than with the chosen antigen. In practice, according to the prior art, the different ends of the linker are chosen according to the reactive groups on the vesicle and the selected antigen involved in the process, in order to have a selective reaction with the intended part, namely the vesicle. on one side and the antigen on the other side terminal. However, these methodologies suffer from certain disadvantages, mainly associated with the selection and functionalization of linkers, thus placing a certain limitation on the choice of the vesicle and the antigen to be coupled together. The applicant has now discovered that when native external membrane vesicles (nOMV) not extracted with a detergent are used as the starting vesicles, it is possible to use a bivalent linker suitable for connection with a protein on the surface of nOMV on one side and with an antigen selected on the other end, thus providing a final conjugate which still exhibits the immunogenic activity of both nOMV and the antigen. Surprisingly, even when the linker used in the present invention has identical terminal functional groups, the conjugation of nOMV with the chosen antigen is obtained substantially without the formation of vesicle aggregates or of secondary products, deleterious for the reaction. of conjugation.
BE2017 / 5856
Summary of the invention
In a first aspect, the invention relates to an immunogenic nOMV-linker-antigen conjugate, comprising a native external membrane vesicle (nOMV) obtained by a detergent-free method, comprising at least one surface protein residue connected to the minus a foreign antigen chosen by a bivalent linker.
In another aspect, the invention relates to a process for preparing said conjugate, comprising the following steps:
i) reacting at least one nOMV surface protein residue with the first terminal part of a bivalent linker to obtain a nOMV-linker intermediate, and ii) reacting said nOMV-linker intermediate with at least one selected antigen via the second terminal part of the bivalent linker, thus obtaining the nOMV-linker-antigen conjugate of the invention.
According to one embodiment, the linker is a bivalent homobifunctional linker, that is to say, comprising the same terminal functionalities. In a still more preferred embodiment, the linker is a bivalent heterobifunctional linker, that is to say, comprising different terminal functionalities.
In another aspect, the invention relates to the nOMV-linker intermediate obtained (or obtainable) by step i) indicated above, and its use for the preparation of the nOMV-linker antigen conjugate of the invention .
In another aspect, ^January 1st invention also relates to the conjugate NOMVs-linker-antigen above for
BE2017 / 5856 use as an immunogenic compound, particularly for the preparation of an immunogenic composition or a vaccine.
In another aspect, the immunogenic conjugates according to the invention comprise a nOMV comprising at least one surface protein group connected to a first antigen by a bivalent linker, where said first antigen is further connected to a different second antigen.
In yet another aspect, the immunogenic conjugates of the invention comprise a nOMV comprising at least one surface protein group connected to a first antigen by a bivalent linker, and at least one other surface protein group connected to a second different antigen by a bivalent linker, where the bivalent linker connecting the first antigen and the bivalent linker connecting the second antigen are independently the same or different from each other.
In yet another aspect, the invention relates to an immunogenic composition or a vaccine, comprising the above-mentioned conjugate and at least one pharmaceutically acceptable carrier or adjuvant, and to a method for producing an immune response in a vertebrate , comprising administering said composition or said vaccine.
In another aspect, the invention relates to the use of nOMV for the preparation of immunogenic polyvalent nOMV-linker-antigen conjugates.
BE2017 / 5856
Brief description of the drawings
FIG. 1 represents the anti-CSP (1A) and anti-OAg (IB) IgG titers after immunization with CSP or its fragment (NANPH conjugated to nOMV of S. typhimurium by SH-maleimido chemistry, compared with CSP physically mixed with said nOMVs (formulated without any adjuvant). Female CD1 mice, 5 weeks old (8 per group) were immunized subcutaneously on days 0 and 28 with 2 μg of CSP / (NANP) 3 by dose The titers were measured on days 0, 14, 28 and 42.
Figure 2: Anti-Pfs25 IgG response induced in mice (200 μΐ per dose injected in SC on days 0 and 28, bled on days 0, 14, 27 and 42) by nOMV conjugates of the invention produced by conjugation nOMV of S. typhimurium with the Pfs25 antigen, via the linker BS3.
Figure 3: IgG anti-fHbp response induced in mice (200 μl per dose injected in SC on days 0 and 28, bled on days 0, 14, 27 and 42) by nOMV conjugates of the invention produced by conjugation nOMV of S. typhimurium with the fHbp antigen, via the linker BS3.
Figure 4: Anti-MenA IgG response induced in mice by nOMV conjugates of the invention produced by conjugation of MenB nOMV with the MenA antigen, via the SIDEA linker, compared to the bivalent MenA-MenC conjugate -GMMA from MenB, to GMMA, to the conjugate of CRM and to the mixture of MenA and GMMA (unconjugated).
BE2017 / 5856
Figure 5: Anti-MenC IgG response induced in mice by nOMV conjugates of the invention produced by conjugation of MenB nOMV with the MenC antigen, via the SIDEA linker, compared to the bivalent MenA-MenC conjugate -GMMA from MenB, to GMMA, to the conjugate of CRM and to the mixture of MenC and GMMA (unconjugated).
Detailed description of the invention
To facilitate understanding of the present invention, a number of terms and phrases are defined below. Synonyms or variations recognized in the art of the following terms and phrases (including past, present, etc.), even if not specifically described, are contemplated.
As used in the present disclosure and the claims, the singular forms "one", "one", "the" and "the" include the plural forms unless the context clearly indicates otherwise; that is, "one" means "one or more" unless otherwise indicated.
The terms "approximately" or "approximately" mean roughly, around, or in the regions of. The terms "approximately" or "approximately" further mean within an acceptable range of contextual errors for the particular value determined by a person of average skill in the field, which will depend in part on how the value is measured or determined , that is, the limitations of the measurement system or the degree of precision required for a particular objective, for example, the quantity
BE2017 / 5856 of a nutrient within a nutritive formulation. When the terms "approximately" or "approximately" are used in conjunction with a numeric range, they modify that range by extending the limits above and below the numerical values presented. For example, "between about 0.2 and 5.0 mg / ml" means that the limits of the numeric range extend below 0.2 and above 5.0 so that the particular value in question is reached the same functional result as within the range. For example, "approximately" and "approximately" may mean 1 or more than 1 standard deviation depending on practice in the art. Alternatively, "approximately" and "approximately" can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably up to 1% a given value.
The term "and / or" as used in a sentence such as "A and / or B" is intended to include "A and B", "A or B", "A", and "B". Similarly, the term "and / or" as used in a sentence such as "A,
B, and / or VS " East supposed to encompass each of the modes of production following: A, B, and C ; AT, B or VS ; AT or VS ; A or B ; B or VS ; A and C; A and B, ; B and C; AT (alone) ; B (alone) ; and C (alone).Except precision contrary to all the designations
"A% -B%", "AB%", "A% to B%", "A to B%", "A% -B", "A% to B", it is given the usual and conventional meaning . In some embodiments, these designations are synonymous.
BE2017 / 5856
The terms "substantially" or "sensitive" mean that the condition described or claimed works in all important aspects like the standard described. Thus, "substantially free" is meant to encompass conditions which work in all important aspects as free conditions, even if the numerical values indicate the presence of certain impurities or substances. "Sensitive" generally means a value greater than 90%, preferably greater than 95%, most preferably greater than 99%. When particular values are used in the specification and in the claims, unless otherwise indicated, the term "substantially" means with an acceptable range of errors for the particular value.
An "effective amount" means an amount sufficient to cause the referenced effect or result.
An "effective amount can be determined empirically and routinely using techniques known in connection with
The stated objective.
As used herein, "heterologous" means that the two or more referenced molecules or structures are derived from a different organism. For example, for a nOMV, a heterologous antigen is one that is derived from an organism different from the nOMV vesicle to which it is appended. "Homologous" as used herein means that the two or more referenced molecules or structures are derived from the same organism.
As used here, "foreign" means that the two or more referenced molecules or structures are not
BE2017 / 5856 not naturally associated with each other. For example, a selected antigen which is here supposed to be "foreign to" a surface saccharide of nOMV here means that the antigen is not naturally or innately conjugated to the surface saccharide and, therefore, is not naturally conjugated to the nOMV molecule even though the antigen and the saccharide (or the nOMV molecule) may come from the same organism. In this way, a foreign antigen is not necessarily a heterologous antigen but a heterologous antigen is a foreign antigen.
"Sequence identity" can be determined by the Smith-Waterman homology search algorithm as implemented in the Oxford Molecular (MPSRCH) program, using an affine gap search with the penalty parameters d gap opening = 12 and gap extension penalty = 1, but is preferably determined by the Needleman-Wunsch global alignment algorithm (see, for example, Rubin (2000) Pediatric. Clin. North Am. 47: 269-285), using the default settings (for example, with a breach opening penalty = 10.0, and with a breach extension penalty = 0.5, using the matrix EBLOSUM62). This algorithm is practically implemented in the Needle tool of the EMBOSS software package. When the request relates to the sequence identity with a particular SEQ ID, the identity is assumed to be calculated over the entire length of that SEQ ID.
The term "w / w in%" indicates the percentage by weight of a given component, relative to a component
BE2017 / 5856 different or from the total content of a composition, as indicated.
Similarly, the term "% v / v" indicates the percentage by volume of a given component, relative to a different component or relative to the total content of a composition, as indicated.
As used herein, the term "saccharide (or sugar) group" includes in its meaning monosaccharides, as well as polysaccharide units. It should be understood that the saccharide groups can exist in open and closed form (cycle) and that, when closed forms are presented here in the structural formulas, the open forms are also encompassed by the invention. Similarly, it should be understood that saccharide groups can exist in forms of pyranose and furanose and that, when forms of pyranose are presented here in the structural formulas, forms of furanose are also encompassed. Different anomeric forms of saccharide groups are also included.
The term "oligosaccharide" includes in its meaning polysaccharides having 3 to 10 monosaccharide units, as is generally known in the art (see, for example, https: //en.wikipedia.org/wiki/Oligosaccharide) .
Unless otherwise provided, the term "polypeptide" refers to polypeptides of any length capable of acting as the chosen antigen. The amino acid polymer forming the polypeptide of the invention can be linear or branched,
BE2017 / 5856 it can contain modified amino acids, and it can be interrupted by non-amino acids. The term also includes an amino acid polymer that has been modified naturally or through intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more amino acid analogs (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art. 'art. The polypeptides can appear as single chains or as associated chains.
The "weight average molecular weight" is intended to indicate the weight average molecular weight obtained by ordinary arithmetic means or the average of the molecular weights of the individual component, for example, amino acids in the case of polypeptide derivatives.
The term "-OAg" (O antigen) is used within the present invention to indicate an antigen functionality present in lipopolysaccharides (LPS) or lipooligosaccharides (LOS) on the surface of the nOMV considered. In more detail, LPS are generally formed from three different parts, known as: lipid A (responsible for the toxicity of LPS), the oligosaccharide nucleus and the -OAg chain, a polymer
BE2017 / 5856 repetitive glycans and the main contributor to the serological specificity of bacteria.
The term "polysaccharides / capsular saccharides" (PSC) indicates those saccharides that may be found in the layer that lies outside the cell envelope of bacteria, thus forming part of the outer envelope of the bacterial cell itself . PSCs are expressed on the outermost surface of a wide range of bacteria, and in some cases even in fungi.
The term "suspension" includes in its meaning a liquid medium having a few precipitates, particles or flocculating particles, unlike a solution where the medium is substantially free of any solid particle.
Unless otherwise provided, the term "conjugation" indicates the connection or binding of the subject entities, particularly with reference to the nOMV and to the chosen antigenic groups, via a bivalent linker.
By "immunologically effective amount" it is meant that the administration of this amount to an individual, either as a single dose or as part of a series, is effective for treatment or prevention. This amount may vary depending on the health and physical condition of the individual to be treated, age, the taxonomic group of the individual to be treated (for example, non-human primate, primate, etc.}, the capacity of the immune system. of the individual to synthesize antibodies, the degree of protection desired, the formulation of the vaccine, the estimation of the
BE2017 / 5856 doctor treating the medical situation, and other relevant factors. It is expected that the amount will fall within a relatively wide range which can be determined through routine testing.
The term "nOMV" here indicates vesicles isolated from the medium and / or detached from cells, and they are intact membrane vesicles not exposed to detergents or denaturing agents, that is to say, not extracted by detergent. The nOMVs of the invention present the outer membrane proteins (OMP) and the lipopolysaccharide (LPS) in their native conformation and correct orientation in the natural membrane environment, and in which the cytoplasmic components are usually lacking.
In contrast, the term "OMV" or "dOMV" encompasses various proteoliposomal vesicles obtained by rupture of the outer membrane of a Gram negative bacterium generally by a process of extraction with a detergent to form vesicles from it. Complexes of outer membrane proteins (for example, Neisseria meningitidis OMPC) can be considered in such a definition, because they have a three-dimensional structure and composition similar to dOMV, and they are isolated by procedures extraction with a detergent (see, for example, documents EP 0467714, US 4,271,147, US 4,459,286 and US 4,830,852). The detergent extraction process removes LPS and phospholipids, together with immunoprotective lipoproteins. Such elimination changes the structure of native vesicles and promotes aggregation. Aggregation can
BE2017 / 5856 lead to significant problems in terms of process development (yield, regularity of production and stability). Unlike nOMVs, characterized by a defined homogeneous distribution of sizes (generally in the range of 20 to 250 nm, measured by the DDL dynamic light scattering technique), dOMVs have an indefinite heterogeneous distribution of sizes (usually in the range of 550 to 5500 nm measured by the dynamic diffusion technique of DDL light) caused by an aggregation of the vesicles induced by the detergent (see for a general reference, Vaccine 28, 2010, 4810). The detergent extraction process also causes contamination of the OMV-containing composition (eg, vaccines) with cytoplasmic proteins as a result of lysis of the bacterial cells.
According to methodologies of the prior art, dOMVs and nOMVs can be analyzed and described in terms of size, shape and overall appearance of impurities or non-OMV contaminating materials (such as vesicle aggregates or residues of detergent in the case of dOMV) using transmission electron microscopy (TEM). For detailed references regarding the differences between dOMVs and nOMVs, see, for example, van de Waterbeemd et al. J. Prot. Res. 12 (4) (2013) 1898-1908 Quantitative Proteomics Reveals Distinct Differences in the Protein. Content of Outer Membrane Vesicle Vaccines; and J. Klimentova et al. Microbiological Research 170 (2015) 1
BE2017 / 5856
Methods of isolation and purification of the outer membrane vesicles from gram-negative bacteria.
The term "bivalent homobifunctional linker" or "homologous linker" indicates a binding unit having two terminal ends carrying the same functional group, and capable of reacting with the protein of nOMV on a side, and with the antigen chosen from on the other hand, where the nOMV protein and the selected antigen are as described below in detail.
Similarly, the term "bivalent heterobifunctional linker" or "heterologous linker" indicates a binding unit having two terminal ends carrying different functional groups, and capable of reacting specifically with the nOMV protein on one side, and with the antigen selected on the other side, where the nOMV protein and the selected antigen are as described below in detail.
The term "bivalent C1 to C _x alkyl or alkenyl group" includes in its meaning a bivalent saturated or unsaturated alkyl or alkenyl group having 1 to x carbon atoms, such as methylene, ethylene, vinyl, allyl and the like.
As has been introduced above, the invention relates to nOMV-linker-antigen conjugates obtained by a covalent connection of at least one protein unit on the surface of the nOMV to one or more selected foreign antigens, by through one or more suitable bivalent linkers. In other words, and according to one aspect, the invention relates to nOMV-linker-antigen conjugates obtained (or which can
BE2017 / 5856 be obtained) by the method of the invention as described below in more detail.
It should be noted that the present conjugates have a remarkable immunogenic activity, as is further supported by the experimental part here. In fact, while being capable of inducing an immune response against the conjugate antigen, the conjugates of the invention are also capable of inducing an immune response against the nOMV component, unlike the conjugates of the art dOMV- antigen where the immune activity rests mainly on the antigen part and not on the vesicle extracted by a detergent. On the contrary, according to the present invention, the conjugation of the selected antigen to the protein component of nOMV, has no significant impact on the ability of nOMV to induce its own immune response. It should be noted that when nOMVs and the selected antigen (s) come from different sources, the conjugates of the invention may be useful, for example, for the preparation of immunogenic compositions or multivalent vaccines based on the activity of both the nOMV and the selected antigen (s).
Furthermore, the present invention surprisingly shows that a homobifunctional linker can be used in the preparation of the nOMV-binding agent antigens, without incurring the problems of the prior art associated, for example, with a cross-reaction or an aggregation of the vesicles. . In practice, the starting nOMV is functionalized with the homobifunctional linker by reacting the correct functional groups of at least one surface protein
BE2017 / 5856 of vesicle with one end of the binder. By this, a nOMV-linker intermediate is formed covalently, always having the other end of the linker available for the subsequent reaction with the selected antigen. Thus, the second end of the linker will react with the chosen antigen, in a specific and selective way, leading to the final conjugate nOMV-linker-antigen, and substantially avoiding cross-reactions or aggregations of intermediates. As shown in Example 8a, the same reaction when performed by considering a dOMV as the starting vesicle leads to the formation of vesicle-linker-vesicle aggregates, which are not suitable for a subsequent reaction with the chosen antigen. Surprisingly, it has now been discovered that not only the use of nOMV as a starting vesicle can overcome the aggregation problems of the prior art, but also it is now possible to use various bifunctional linkers which lead to the preparation of a whole series of nOMV-linker-antigen conjugates according to the invention, preserving the immunogenic profile of the conjugated components.
The conjugates of the invention offer several advantages over unconjugated antigens, for example, the ability to act as an immunogenic agent or a bivalent or multivalent vaccine as discussed above, and improved immunogenicity compared to antigens unconjugated (see examples 5 and 7). In addition, the conjugates of the invention have several advantages over the vesicle protein conjugates which have been used to date. In
BE2017 / 5856 first, nOMVs can be prepared with fewer steps compared to dOMV conjugates in which antigens have been coupled to dOMV proteins, and in particular without requiring the costly and time consuming step of protein derivatization. Second, the production of nOMVs can be more reliable and convenient than the preparation of dOMVs by extraction with a detergent. Even more, the unreacted antigen from the conjugation mixture can be recycled for use in another conjugation step, improving the production efficiency of the conjugates as illustrated in Example 3.
In a first aspect, the invention relates to a conjugate comprising one or more different foreign antigens chosen, each connected to a protein residue of a vesicle of native external membrane not extracted by a detergent (nOMV), via of a bivalent binder. Note that nOMVs can be collected and isolated substantially without the use of detergents, unlike, for example, prior art dOMVs obtained by extraction with deoxycholate or by using zwitterionic detergents like Empigen BB (see, for example, US 4,707,543) or the like.
In more detail, nOMVs are naturally occurring membrane vesicles which form spontaneously during bacterial growth and which are released into the culture medium. They can be obtained, for example, by culture of bacteria in a broth culture medium, by separating the
BE2017 / 5856 whole cells of smaller nOMVs in the broth culture medium (for example, by filtration or low speed centrifugation to aggregate only the cells and not the smaller vesicles), and then collecting the nOMVs from medium depleted in cells (for example, by filtration, by differential precipitation or aggregation, by high speed centrifugation to aggregate the vesicles). Strains for use in the production of nOMV can generally be chosen based on the amount of nOMV produced in culture. As presented above, the present nOMVs are characterized by the fact that they are collected and isolated following a procedure devoid of detergent. Preferably, the present nOMVs are released into the fermentation broth and are purified using centrifugation and a subsequent filtration step (for general reference, see, for example, Clin Vaccine Immunol. April 2016; 23 (4): 304 -314). More preferably, the present nOMVs are released into the fermentation broth and are purified using the following two consecutive steps of tangential flow filtration (FFT): (i) microfiltration in which the culture supernatant containing the nOMVs is separated from bacteria, and (ii) ultrafiltration in which nOMVs are separated from soluble proteins (for a general reference, see, for example, PLoS One. 2015; 10 (8):
e0134478). The nOMVs thus obtained can then be used directly within the present invention without any additional purification / isolation step. The
BE2017 / 5856 nOMV presently considered have a preferred size distribution between 20 and 250 nm, measured by the dynamic light scattering technique.
According to some embodiments, nOMVs are prepared from wild type bacteria or from bacteria that have been genetically engineered in general to increase immunogenicity (for example, to hyper-express immunogens), to reduce toxicity , to inhibit the synthesis of capsular saccharides, to negatively regulate the expression of immunodominant antigens, and the like. They can also be prepared from hyperburgical strains. The nOMVs of the invention can also express exogenous proteins on their surface and they can be depleted of endotoxin.
Preferably, the nOMVs to be used in the present invention are produced from genetically modified bacterial strains which are mutated to amplify the production of vesicles, and possibly also to eliminate or modify antigens (for example, lipid A) and / or to overexpress homologous antigens or antigens from other organisms. Said preferred nOMVs are also known as generalized modules of membrane antigens (GMMA) as described, for example, in PLoS One. 2015; 10 (8): e0134478.
Amplified spontaneous vesicle production can be achieved, for example, by a targeted deletion of proteins involved in maintaining the integrity of the membrane. It has been observed that the external surface
BE2017 / 5856 of nOMVs corresponds substantially to the external surface of the bacteria from which they are derived, preserving membrane antigens (including, for example, lipopolysaccharides, lipooligosaccharides and lipoproteins) in the context of the membrane. Advantageously, the nOMVs used in the invention (unlike the dOMVs extracted by a detergent) retain these components of the outer membrane in their native conformation and correct orientation, better preserving immunogenicity against the bacterial strain from which they are derived.
Generally, nOMVs for use in the present invention can be prepared from any suitable bacteria, where preferred bacteria include, but are not limited to: Neisseria (for example, especially N. meningitidis of any serogroup including A, B, C, X, Y or W135, or from a non-pathogenic Neisseria), Shigella (as
S. sonnei, S. flexneri, dysenteriae or boydii), serovars of Salmonella enterica. (such as Salmonella paratyphi _r Salmonella enteritidis, Salmonella typhi or Salmonella typhimurium), Haemophilus influenzae (for example, non typable H. influenzae), Vibrio cholerae, Bordetella pertussis, Mycobacterium smegmatis, Mycobacterium bovis BCG, Escherichia coli ), Pseudomonas aeruginosa, Helicobacter pylori, Brucella melitensis Campylobacter jejuni, Actinobacillus actinomycetemcomitans, Xenorhabdus nematophilus, Moraxella catarrhalis, or Borrelia burgdorferi.
BE2017 / 5856
The particularly preferred bacteria are chosen from at least one of: S. sonnei, S. flexneri, the bacteria Salmonella, and the meningococcus.
Virulent Shigella strains have a 220 kb plasmid that mediates virulence properties. This "virulence plasmid" has been shown to encode genes for several aspects of Shigella virulence, including adhesins for target epithelial cells, invasive plasmid antigens, virF, virG, and the like. A Shigella used with the invention may or may not have a virulence plasmid. The absence of the plasmid can stabilize the strain during industrial culture, attenuate the strain by eliminating virulence factors (thereby increasing the safety of manufacture), avoid the presence of the enterotoxin ShET2 (coded by the ospD3 gene or sen on the plasmid), and avoid the presence of msbB2 which is a second copy of the msbB gene responsible for the acylation of lipid A.
As far as the Salmonella bacterium is concerned, a particularly preferred strain is chosen from: Salmonella typhimurium, Salmonella enteritidis and Salmonella paratyphi A.
The nOMVs of the Meningococcus bacteria are also preferred. Such vesicles can be prepared from any meningococcal strain. The vesicles are preferably prepared from a strain of serogroup B, but it is also preferred to prepare them from serogroups other than B, such as one of: A, C, W135 or Y. The strain can be of any serotype (for example, 1, 2a, 2b, 4, 14, 15, 16, etc.),
BE2017 / 5856 any sero-subtype (for example, Pl.4), and any immunotype (for example, LI; L2; L3; L3,7; L3,7,9; LIO; etc,). The meningococci can be of any suitable line, including hyper-invasive and hypervirulent lines, preferably any one of the following seven hypervirulent lines: subgroup I; subgroup III; subgroup IV-1; ET-5 complex; ET-37 complex; group A4; line 3. Most preferably, the OMVs are prepared from the strain NZ98 / 254, or another strain with the sero-subtype of PorA PI.4.
In another embodiment, the bacteria for the preparation of the nOMVs useful for the invention can be mutant strains which have been manipulated, for example, to amplify the production of the vesicles, to express one or more desired antigens, and / or to inactivate or modify an unwanted gene (for example, one that codes for a toxin or that codes for an enzyme involved in the production of a toxic product, such as an endotoxin).
In this direction, other nOMVs for the invention are produced by a Salmonella bacterium, particularly an S. typhimurium (also known as Salmonella enterica serovar typhimurium) which does not express a functional TolR protein.
When the vesicles are prepared from E. coli, Shigella or Salmonella, the bacteria cannot express more than 4 of the proteins TolA, TolB, TolQ, TolR and Pal. Thus, at least one protein from the system of five natural Tol-Pal proteins may be absent, resulting in a bacterium which, during
BE2017 / 5856 growth in the culture medium, releases greater amounts of external membrane vesicles in the medium compared to the same bacteria expressing the 5 Tol-Pal proteins. Preferably TolR is not expressed, but the other four proteins can be expressed (i.e., an ATolR strain).
In preferred embodiments, at least one of the five Tol-Pal proteins in E. coli, Shigella or Salmonella is eliminated, for example, by deletion or inactivation of the gene encoding the protein. Thus, the bacteria can express 0, 1, 2, 3 or 4 of the proteins TolA, TolB, TolQ, TolR and Pal. Elimination of one of the five proteins may suffice, in which case the bacteria expresses only 4 of these proteins. Preferably, the TolR protein is eliminated, for example, by inactivation of the tolR gene from a starting strain. Thus, a preferred bacterium can be tolA + to! B + tolQ + TolRPal +.
In some embodiments, the bacteria express the five Tol-Pal proteins, but at least one is mutated to cause hyper-budding. For example, the protein TolA, TolQ, TolR and / or Pal can be mutated in such a way that the protein retains its membrane localization but its interactions with the other members of the Tol-Pal system are disturbed. The bacteria will thus keep TolA, TolQ and TolR as transmembrane proteins in the internal membrane, and the Pal protein as lipoprotein facing the periplasm in the external membrane, but at least one of the proteins TolA, TolQ, TolR and / or Pal is mutated and not fully functional.
BE2017 / 5856
In addition, other mutations may also be present, for example, to give OAg-deficient strains, such as AgalU, AgalE or AwbaP in strains of E. coli, Shigella or Salmonella.
In another preferred embodiment, a meningococcus does not express a functional MltA protein. Inactivation of MltA (lytic membrane-bound transglycosylase, also known as GNA33) in meningococcus provides bacteria that spontaneously release large amounts of nOMV into the culture medium, from which they can be easily purified . For example, the vesicles can be purified using the two-step size filtration process, comprising: (i) a first filtration step in which the vesicles are separated from bacteria based on their different sizes, with the vesicles passing in the filtrate; and (ii) a second filtration step in which the vesicles are retained in the retentate.
In the present invention, it is preferred that -OAg is present on nOMVs because it has been observed (for example, nOMVs originating from Salmonella and Shigella) that, the presence of 1'-OAg on the surface of said nOMV is advantageous in providing a bivalent vaccine because 1'-OAg can act as a protective antigen Some preferred strains have a less toxic penta- or tetra-acylated LPS, which includes fixed-OAg, after the mutation of msbB, htrB, ddg and / or PagP (see, for example, Rossi O et al., Clin Vaccine
BE2017 / 5856
Immunol. April 4, 2016; 23 (4}: 304-14 and Rossi 0 et al. _R J Biol Chem. September 5, 2014; 289 (36}: 24922-35.
In Neisseria, the strain preferably includes a modified fur gene. According to this embodiment, the mutant Neisseria are modified to reduce or deactivate the expression of at least one gene involved in rendering the lipid A part of the LPS toxic, in particular of the lpxll gene. In this way, the resulting nOMVs exhibit reduced toxicity compared to the wild type strain, since the conversion of acylated lipid A to a less acylated form.
Similarly, the preferred mutant Neisseria for the invention are modified to reduce or deactivate the expression of at least one gene involved in the synthesis or export of capsular saccharides, in particular the synX and / or ctrA genes. In this way, the resulting nOMVs can exhibit cross-protection against various serotypes, which is particularly appreciated by those skilled in the art.
In preferred embodiments, a strain may include one or more of the inactivation and / or hyper-expression mutations disclosed, for example, in Fukusawa et al. (1999), Vaccine 17: 29512958. For example, following the advice and the nomenclature indicated therein, the genes useful for negative regulation and / or inactivation include: (a) Cps, CtrA, CtrB, CtrC, CtrD, FrpB, GalE, HtrB / MsbB, LbpA, LbpB, LpxK, Opa, Ope, PilC, PorB, SiaA, SiaB, SiaC, SiaD, TbpA, and / or TbpB; (b) CtrA, CtrB, CtrC, CtrD, FrpB, GalE, HtrB / MsbB, LbpA, LbpB, LpxK, Opa, Ope, PhoP, PilC, PmrE, PmrF, SiaA, SiaB, SiaC, SiaD, TbpA, and / or
BE2017 / 5856
TbpB; (c) ExbB, ExbD, rmpM, CtrA, CtrB, CtrD, GalE, LbpA, LpbB, Opa, Opc, PilC, PorB, SiaA, SiaB, SiaC, SiaD, TbpA, and / or TbpB; or (d) CtrA, CtrB, CtrD, FrpB, OpA, OpC, PilC, PorB, SiaD, SynA, SynB, SynX and / or SynC.
As mentioned above, nOMVs are covalently linked to the bifunctional linker by means of at least one protein residue, usually located on the surface of the vesicle. In this direction, the proteins will preferably react with a terminal end of the linker by means of one or more amino, thiol or hydroxyl functional groups of amino acids, the latter being an alpha-hydroxyl group or part of the carboxy functional group d 'amino acid. Preferably, the functional group of the protein is an amino group, more preferably a primary amine (-NH2). These functional groups can be naturally present in the amino acid parts of interest, or even introduced artificially for the purposes of conjugation.
When the linker chosen is a bivalent homobifunctional linker, it should be understood that the functional group of the protein and the functional group of the antigen which will react respectively with the terminal parts of the linker will preferably be identical. For example, a lysine amino acid residue from one or more nOMV proteins will react with the linker (for example, BS3) via the corresponding -NH2 functional group. Likewise, also a selected antigen (eg, Pfs25) will react with the remaining free terminal portion of the linker via relevant amino groups (-NH2).
BE2017 / 5856
Note, and as is well explained in the present description, the reaction occurs without cross-reaction or formation of sensitive aggregation, thus leading to the final product, useful, for example, for the preparation of multivalent vaccines, in a very reliable and versatile, and differently from using dOMV, as shown in Examples 8 and 8a (comparative).
Preferred amino acid residues include, but are not limited to: arginine, lysine, asparagine, glutamine, aspartic or glutamic acid, cysteine and histidine. Preferably, the proteins of the nOMVs are those comprising one or more amino acid groups having free amino groups, preferably groups -NH2. Even more preferably, said amino acid group is arginine and / or lysine, whereby different -NH2 groups originating from proteins different from arginine and / or lysine are capable of reacting selectively with the linker according to the present invention.
As far as the bivalent linker is concerned, it is generally a molecule of a certain length, having a solubility in water and an appropriate polarity, capable of covalently binding the proteins of the nOMVs and the antigen by its terminal ends respectively. In order to optimize the solubility of the chosen linker, it may be appropriate to introduce one or more polar groups such as sulphate, sulphite, phosphate and the like, or even to use their corresponding salt, for example,
BE2017 / 5856 in the form of an alkali or alkaline earth metal salt, when possible. Thanks to the versatility of the present invention, it is possible to use different linkers, in terms of, for example, length, polarity, and steric bulk, thereby providing a covalent bond with both protein residues of nOMV and the selected antigen. By this, the invention allows the preparation of a whole series of final nOMV-linker-antigen conjugates endowed with remarkable and specific behavior, in particular as regards their immunogenicity and activity.
The linker can be heterobifunctional (that is to say, carrying two different terminal functionalities) or, preferably homobifunctional (that is to say, comprising equal terminal functionalities). Even more preferably, the linker is symmetrical about a hypothetical vertical axis.
Thus, the bivalent linker according to the present invention has a general formula (I):
X-L-X '(I) in which:
X and X 'are different from each other or identical, and represent a functional group capable of reacting selectively with the proteins of the nOMVs on the one hand and with the selected antigen on the other hand, preferably by forming ester groups, amido thioester;
-L- represents an optionally substituted linear or branched bivalent C1 to Cis alkyl or alkenyl group,
BE2017 / 5856 and possibly interrupted by one or more heteroatoms chosen from: oxygen (—O—), sulfur (-S-), nitrogen (-NH- or an optionally substituted group -N-) and the like.
In one embodiment, -L- preferably represents a divalent linear C ₃ -C12 alkyl group, optionally substituted or interrupted by one or more oxygen heteroatoms (-O-). In an even more preferred embodiment, -L- represents a bivalent linear C ₃ -C 6 alkyl group.
According to formula (I), the linker is further characterized in that it has the two end portions carrying two functionalities X and X 'which are preferably identical, thus providing a bivalent homofunctional linker. In one embodiment, the groups X and / or X 'can be any forming esters, thioesters or amides when combined with hydroxyl, thiol or amino functionality, respectively.
Preferably, X and / or X ′ represent N-hydroxysuccinimide ester conjugates, more preferably chosen from at least one of:
in which the * represents the point of contact with the spacer -L- in the formula (I), as defined above.
BE2017 / 5856
Thus, in a more preferred embodiment, the linker is chosen from at least one of: disuccinimidyl glutarate (DSG), disuccinimidyl suberate (DSS), succinimidyl 3- (2-pyridyldithio) propionate ( SPDP), 6- (3- [2-pyridyldithio] propionamido) succinimidyl hexanoate (LC-SPDP), 6 (3 ¹ - (2-pyridyldithio) propionamido) sulfosuccinimidyl hexanoate (sulfo-LC-SPDP) 4-succinimidyloxycarbonyl-a-methyl-ct.- (2-pyridyldithio) toluene (SMPT), 6- [α-methyl-a- (2-pyridyldithio) toluenamido] sulfosuccinimidyl hexanoate (suifo-LC-SMPT) Succinimidyl 4- (N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC), sulfosuccinimidyl 4- (N-maleimidomethyl) cyclohexane-1-carboxylate (sulfoSMCC), m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS) the ester of m-maleimidobenzoyl-Nhydroxysulfosuccinimide (sulfo-MBS), the (4iodoacetyl) aminobenzoate of N-succinimidyl (SIAB), the (4-iodoacetyl) aminobenzoate of sulfosuccinimidyl (sulfo-SIAB), succinimidyl 4- (N-maleimidophenyl) butyrate (SMPB), sulfosuccinimidyl 4- (N-maleimidophenyl) butyrate (sulfo-SMPB), Ν-γmaleimidobutyryl oxysuccinimide ester (GMBS) -ymaleimidobutyryl-oxysulfosuccinimide (sulfo-GMBS), 6 - (((((4- (iodoacetyl) amino) methyl) cyclohexane-1carbonyl) amino) succinimidyl hexanoate (SIACX), 6 [6 - (((iodoacetyl) amino ) hexanoyl) amino] succinimidyl hexanoate (SIAXX), 4 - (((iodoacetyl) amino) methyl) cyclohexane-1-succinimidyl carboxylate (SIAC), 6 - [(iodoacetyl) amino] succinimidyl hexanoate (SIAX) and p-nitrophenyl iodoacetate
BE2017 / 5856 (NPIA), N-hydroxysuccinimide, N-oxysuccinimide and the diester of N-hydroxysuccinimide adipic acid (SIDEA) and bis suberate (suifosuccinimidyle) (BS3, CAS No. 82436-77-9 ).
In one embodiment, other preferred bifunctional linkers reactive with amines for use with the invention are selected from at least one of: acryloyl halides (e.g., chloride), ethylene glycol bis [succinimidyl succinate], bis (sulfosuccinimidyl) -tri (ethylene glycol) (BS (PEG) 3), bis (sulfosuccinimidyle) tetra (ethylene glycol) (BS (PEG) 4), bis (sulfosuccinimidyle) - penta (ethylene glycol) (BS (PEG) 5) and bis (sulfosuccinimidyle) hexa (ethylene glycol) (BS (PEG) 6), where bis (suifosuccinimidyle) -penta (ethylene glycol) (BS (PEG) 5, CAS No. 756526-03-1) is particularly preferred.
The preferred homobifunctional linkers capable of reacting with thiol functional groups on the nOMV protein and the antigen according to the invention are those having X and X 'chosen from at least one of: 2-pyridyldithio residues, maleimide or iodoacetyl.
Other linkers suitable for the reaction with the hydroxyl group of the nOMV protein as defined above are chosen from at least one of: adipic acid dihydrazide (ADH), the βpropionamido group, nitrophenyl-ethylamine, haloacyl halides ^1, the 6-aminocaproic acid.
The preferred linkers are chosen from at least one of: (BS (PEG) 5), disuccinimidyl glutarate (DSG)
BE2017 / 5856 or one of its salts, SIDEA and BS3, where BS3 is even more preferred (for a general reference on BS3, see, for example, US Patent 4,965,338). According to a still more preferred embodiment, the DSG is particularly useful when operating at a pH around 9. Surprisingly, the efficiency of the conjugation reaction can be increased in practical terms when (BS (PEG) 5) or BS3 are used as a bivalent linker, substantially in the absence of the formation of vesicle aggregates. In this regard, it should be emphasized that the use of BS3 according to the present invention does not provide substantial crosslinking of the surface proteins of the nOMVs to form high molecular weight aggregates, but rather, a selective reaction with the nOMVs on one end. terminal, and with the antigen chosen on the other end. This behavior is further supported by the experimental part included here, in which Example 8 and Example 8a (comparative, using dOMV) are described.
Advantageously, any correct antigen can be conjugated to nOMV to obtain the nOMVlieur-antigen conjugates of the invention. In all cases, the connection of one or more selected antigens produces an immunogenic conjugate which can produce an immune response which recognizes said antigen, and which also recognizes one or more components in nOMV, thereby conveniently providing a multivalent vaccine . The antigens will be included in the present conjugate at a concentration which is high enough to trigger, when they are
BE2017 / 5856 administered to a host, an immune response that recognizes this antigen. In addition, the immune response is preferably protective against the pathogen from which the antigen was derived, even more preferably against one of the pathogens listed below.
In one embodiment of the invention, the nOMV is conjugated to at least one homologous antigen, that is to say derived from the same organism from which the nOMV is derived. In a still more preferred embodiment, the antigen chosen is a heterologous antigen, that is to say derived from an organism different from the organism from which the nOMV is derived.
In all cases, the antigens are generally chosen from any immunogenic polypeptides, that is to say polypeptides capable of triggering an immune response when they are administered to a subject. The polypeptides used with the invention will comprise an amino acid having a residue, or a side chain, with a functional group suitable for conjugation, preferably an amino or thiol group, even more preferably of general formula: -NH2 or - SH. These residues can be naturally present in an antigen, or they can be introduced artificially for the purposes of conjugation. Preferred amino acid residues include, but are not limited to: arginine, lysine, asparagine, glutamine, cysteine and histidine. The most preferred amino acid residue for conjugation is lysine.
BE2017 / 5856
The nOMV-conjugated polypeptide antigens are preferably prepared in a substantially pure or substantially isolated form (i.e., substantially free of other polypeptides). They can be prepared by various means, for example, by chemical synthesis (at least in part), by digestion of longer polypeptides using proteases, by translation from RNA, by purification from a cell culture ( for example, from recombinant expression or from native culture), and the like. Recombinant expression in a host of E. coli is a useful route of expression. Polypeptide antigens can take various forms (eg, native, fusions, glycosylated, unglycosylated, lipid, disulfide bridges and the like).
The polypeptide antigens used with the invention have a preferred weight average molecular weight of at least 1 kDa, more preferably at least 3.5 kDa, even more preferably from 10 to 80 kDa. Even more preferably, the weight average molecular weight is from 15 to 75 kDa.
Other preferred polypeptide antigens for conjugation to nOMVs according to the present invention include an epitope from a fungal, bacterial, protozoan or viral polypeptide. Preferred protozoan polypeptides are from a Plasmodium (such as P. falciparum, P. vivax, P. ovale). The particularly preferred bacterial polypeptides are chosen from: E. coli, N. meningitidis, and streptococci (such as S. agalactiae, S. pneumoniae,
S. pyogenes).
BE2017 / 5856
E. polypeptide antigens. preferred coli include CTF1232 (SEQ ID NO: 14), 3526 (SsIE, SEQ ID NO: 15) and 405 (FdeC, SEQ ID NO: 16). As a preferred non-limiting example, nOMVs from Shigella or Salmonella can be conjugated to CTF1232, 3526 or 405, according to the present invention, to produce a bivalent vaccine covering both enterotoxigenic E. coli (ETEC) and Shigella / Salmonella.
In one embodiment, the N. meningitidis polypeptides under consideration are capable, when administered to a mammal, of triggering an antibody response which is bactericidal against meningococcus. Preferred N. meningitidis polypeptides for use with the invention are selected from at least one of: NHBA, NadA, NsPA, NhhA, App and fHbp, as detailed below.
NHBA antigen
The NHBA antigen was included in the published genomic sequence for the meningococcal strain B serogroup MC58 as gene NMB2132 (GenBank accession number GI: 7227388; SEQ ID NO: 2 here). NHBA antigen sequences for many strains have been published since then. Various immunogenic fragments of the NHBA antigen have also been reported. Preferred NHBA antigens for use with the invention include an amino acid sequence:
(at) with 50% or more identity (for example, 60 %, 65%, 70 9- Ί 5%, 80% , 85%, 90% , 91%, 92%, 93 %, 94%, 95 %, 96 %, 97%, 98%, 99%, 99.5% or more, through example 100 %) with SEQ ID NO : 2; and or (B) comprising a fragment at least "N" acids
BE2017 / 5856
amino consecutive from SEQ ID NO : 2 , in which " not " worth 7 or more (through example, 8 10 12, 14 , 16, 18, 20 25, 30, 35, 40, 50 60, 70, 80, 90 100 150, 200, 250
or more). The preferred fragments of (b) comprise an epitope derived from SEQ ID NO: 2. The most useful NHBA antigens of the invention can trigger antibodies which, after administration to a subject, can bind to a meningococcal polypeptide consisting of amino acid sequence SEQ ID NO: 2. NHBA antigens advantageous for use with the invention can trigger bactericidal meningococcal antibodies after administration to a subject.
NadA antigen
The NadA antigen was included in the published genomic sequence for the meningococcal serogroup B strain MC58 (see, for example, Tettelin et al. (2000) Science 287: 1809-1815) as the gene NMB1994 (number accession GenBank GI: 7227256; SEQ ID NO: 3 here). The NadA gene sequences of many strains have been published since then, and the activity of the protein as neisserial adhesin has been well documented. Various immunogenic fragments of NadA have also been reported. Preferred NadA antigens for use with the invention include an amino acid sequence (a) having 50% or more
identity (for example, 60%, 65 %, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94 %, 95%, 96%, 97%, 98%, 99%, 99.5% or more, by example 100%) with SEQ ID NO: 3; and / or (b) comprising a fragment from to
minus "n" consecutive amino acids of SEQ ID NO: 3, in which "n" is 7 or more (for example, 8, 10,
BE2017 / 5856
12, 14, 16, 18, 20, 25, 30, 35, 4 0, 50, 60 70, 80, 90, 100, 150, 200, 250 or more ^ ). The fragments favorite of (b) include an epitope from from SEQ ID NO: 3. The NadA antigens favorite Between all of 1'invention
antibodies can trigger administration to a subject, meningococcal polypeptide can consist of binding to an amino acid sequence SEQ ID NO: 3. NadA antigens advantageous for use with the invention can trigger bactericidal meningococcal antibodies after administration to a subject.
SEQ ID NO: 7 is one such fragment.
Antigen
NspA was included in the published genomic sequence for the meningococcal serogroup B strain MC58 (see, for example,
Tettelin et al.
(2000) Science 287:
1809-1815) as an NMB0663 gene (accession number here). The NspA antigen sequences of many strains have been since then. Various immunogenic fragments of
NspA have also been reported. Preferred NspA antigens for use with
the invention include a acid sequence amines: (at) with 50% or more d ¹ identity (per example, 60 %, 65%, 70 £, Ί R 9- o _f / "J o _f . 80 î ⁵ l 85%, 90%, 91 %, 92%, 93 %, 94%, 95 %, 96%, 97%, 98 %, 99%, 99.5% ; or more, through example 100%) with SEQ ID NO: 4 ; and or (B) comprising a fragment of at least "n »Acids
of SEQ ID which "
No "
4, in is 7 or more (for example, 8,
10, 12, 14, 16, 18,
20
25, 30, 35, 40, 50, 60, 70, 80,
90, 100, 150, 200,
250
BE2017 / 5856 or more). The preferred fragments of (b) comprise an epitope derived from SEQ ID NO: 4. The most preferred NspA antigens of the invention can trigger antibodies which, after administration to a subject, can bind to a meningococcal polypeptide consisting of amino acid sequence SEQ ID NO: 4. The NspA antigens advantageous for use with the invention can trigger bactericidal meningococcal antibodies after administration to a subject.
NhhA antigen
The NhhA antigen was included in the published genomic sequence for the serogroup B meningococcal strain MC58 (see, for example, Tettelin et al. (2000) Science 287: 1809-1815) as the NMB0992 antigen (number d 'accession GenBank GI: 7226232; SEQ ID NO: 5 here). The NhhA antigen sequences of many strains have been published since then, for example, WO 00/66741 and WO 01/55182, and various immunogenic fragments of NhhA have been reported. He is also known as Hsf. Preferred NhhA antigens for use with the invention include an amino acid sequence: (a) having 50% or more
identity (e.g. 60%, 65 %, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94 %, 95%, 96%, 97%, 98%, 99%, 99.5% or more, through example 100%) with
SEQ ID NO: 5; and / or (b) comprising a fragment of at least "n" consecutive amino acids of SEQ ID NO: 5, in which "n" is 7 or more (for example, 8, 10, 12, 14, 16, 18 , 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 or more). The favorite fragments of
BE2017 / 5856 (b) comprise an epitope derived from SEQ ID NO: 5. The most preferred NhhA antigens of the invention can trigger antibodies which, after administration to a subject, can bind to a meningococcal polypeptide consisting of the sequence of amino acids SEQ ID NO: 5. The NhhA antigens advantageous for use with the invention can trigger anti meningococcal bactericidal antibodies after administration to a subject.
Antigen App
The App antigen was included in the published genomic sequence for the serogroup B meningococcal strain MC58 (see, for example, Tettelin et al. (2000) Science 287: 1809-1815) as an antigen
NMB1985 (GenBank GI accession number: 7227246;
SEQ ID NO: 6 here). The App antigen sequences of many strains have been published since then. Various immunogenic fragments of App have also been reported. Preferred App antigens for use with the invention include an amino acid sequence:
(a) with 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95% , 96%, 97%, 98%, 99%, 99.5% or more, for example 100%) with SEQ ID NO: 6; and / or (b) comprising a fragment of at least “n” consecutive amino acids of SEQ ID NO: 6, in which “n” is 7 or more (for example, 8, 10, 12, 14, 16, 18 , 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 or more). The preferred fragments of (b) comprise an epitope derived from SEQ ID NO: 6. The most preferred NhhA antigens of the invention can trigger
BE2017 / 5856 antibodies which, after administration to a subject, can bind to a meningococcal polypeptide consisting of the amino acid sequence SEQ ID NO: 6. App antigens advantageous for use with the invention can trigger meningococcal antibodies bactericides after administration to a subject.
FHbp antigen
The factor H binding protein exists in the form of three variants (v1, v2 and v3), and the invention may use any of these as a preferred embodiment.
A v1 of fHbp preferably comprises (a) an amino acid sequence which has at least k '% identity with SEQ ID NO: 8, and / or (b) a fragment of SEQ ID NO: 8. k' relates to a percentage of identity and can be defined as any number from 1 to 100. With reference to the amino acid or nucleic acid sequences, the identity used in the application generally starts as low as 40% with specific references to higher percentages, i.e., 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% , 98%, 99%, 99.5% or more, for example 100%.
The fragment will preferably comprise at least one epitope derived from SEQ ID NO: 8. Preferably, the v1 of fHbp can trigger antibodies which are bactericidal against the v1 strains, for example against the MC58 strain (available from ATCC in as "BAA-335").
An fHbp v2 preferably comprises (a) an amino acid sequence which has at least k '%
BE2017 / 5856 of identity with SEQ ID NO: 1, and / or (b) a fragment of SEQ ID NO: 1. Information concerning k 'and the fragments is given above. The fragment will preferably comprise at least one epitope derived from SEQ ID NO: 1. Preferably, the v2 of fHbp can trigger antibodies which are bactericidal against strains v2, for example, against the strain M2091 (ATCC 13091).
An fHbp v3 preferably comprises (a) an amino acid sequence which has at least k '% identity with SEQ ID NO: 9, and / or (b) a fragment of SEQ ID NO: 9. Information concerning k 'and the fragments are given above. The fragment will preferably comprise at least one epitope derived from SEQ ID NO: 9. Preferably, the vH of fHbp can trigger antibodies which are bactericidal against strains v2, for example, against the strain M01-240355.
The group A Streptococcus (GAS), group B Streptococcus (GBS) and Pneumococcus antigens are also equally preferred. As nonlimiting examples, the antigens GAS25 (Slo), GAS40 (SpyAD) and GAS57 (SpyCEP) can be incorporated into conjugates in accordance with certain embodiments of the invention.
Plasmodium antigens are also preferred. These can come from any suitable species, where the preferred species are chosen from: P. falciparum _r P. vivax and P. ovale.
Yet another preferred antigen is Pfs25 (SEQ ID NO: 10), which is an antigen of the sexual stage of P. falciparum expressed on the surface of the zygote and akinetic forms of the parasite. Another preferred antigen is
BE2017 / 5856
Pfs48 / 45, which is a candidate vaccine that blocks transmission. Recently, the C-terminal fragment of 10 cysteines (10C) from Pfs48 / 45, containing three epitopes known for antibodies blocking transmission, was produced in the form of a chimera with the N-terminal part of GLURP (RO) , the protein rich in antigen glutamate from the asexual blood stage. The resulting fusion protein (RO10C) triggered high levels of transmission blocking antibodies in rodents (see, Theisen et al. (2014) Vaccine 32: 2623-2630).
Shing et al. (2015) Vaccine 33: 1981-1986 describe a chimera containing truncated fragments of 6C, which increases the yield of the correctly folded conformer. The RO6C construct was able to trigger a high titer of transmission blocking antibodies in rats. RO6C (SEQ ID NO: 11) is a preferred antigen which can be conjugated according to the present invention.
Another preferred antigen is the circumsporozoite protein (CSP; SEQ ID NO: 12).
Shorter peptides from CSP can also be conjugated according to the present invention. For example, the 12 amino acid peptide (NANP) 3 (SEQ ID NO: 13) derived from CSP can be used according to preferred embodiments.
In yet another preferred embodiment, the antigens are a species of saccharide. The invention is in fact also suitable for conjugating one or more saccharide antigens to nOMVs, whereby the saccharides can be used in their natural full-length form. Alternatively, a grouping of a particular size can be
BE2017 / 5856 also advantageously chosen. Thus, the saccharides can be fragmented from their natural length, and optionally a size grouping of these fragments can be used. Even further, saccharides are not limited to saccharides purified from natural sources and synthetic or semi-synthetic saccharides can be used instead. The polysaccharide antigen to be used according to the invention is generally functionalized in order to allow the reaction with the in one embodiment, when the antigen is a polysaccharide, the invention comprises an antigen hydroxyl group anomer of said aldehyde, this followed by conversion by oxidation of the reducing amination to the amino group, for example, using NaICh and NaBlU, according to procedures known in the art. In this way, the polysaccharide antigen will present a group -NH2 suitable for the reaction with the terminal part of the linker, already connected to the nOMV to give the conjugate nOMV-antigen linker.
Preferred saccharide antigens are bacterial capsular saccharides (PSCs). These include, but are not limited to, the capsular saccharides selected from at least one of: Haemophilus influenzae type B; Neisseria meningitidis of serogroups A, C, W135, X and Y, where serogroups A and C are particularly preferred; Streptococcus pneumoniae serotypes 1, 2, 3, 4, 5, 6A, 6B, 7F, 8, 9N, 9V, 10Ä, 11A, 12F, 14, 15B, 17F, 18C, 19A, 19F, 20,
22F, 23F, and 33F; Salmonella including Salmonella
BE2017 / 5856 enterica serovar typhi Vi, either full length or fragmented (indicated by fVi); Streptococcus agalactiae of serotypes la, Ib, and III; Streptococcus pyogenes, Shigella sp.
In a preferred embodiment, the nOMV is a GMMA originating from the bacterium Meningococcus, preferably prepared from a strain of serogroup B, and the antigen chosen is a capsular saccharide originating from Neisseria meningitidis of serogroups A or C, even more preferably conjugated to GMMA via a SIDEA linker.
In all cases, and as mentioned above, the antigens chosen can be conjugated to nOMVs derived from the same bacterial strain and even from a different bacterial strain, thus providing a multivalent conjugate. In this regard, in a more preferred embodiment of the invention, the nOMV and the saccharide antigen are derived from different bacterial strains.
Other preferred saccharide antigens are ß-glucans, which are particularly useful for protection against C. albicans (for general reference, see Sandlin et al. (1995) Infect. Immun., 63: 229-37).
Other preferred saccharide antigens are poly-rhamnose oligosaccharides for protection against group A Streptococcus (GAS). The native GAS saccharide has a poly-rhamnose backbone substituted with NAcGlcN. Synthetic polyrhamnose oligosaccharides, or oligomers with the structure of the native GAS saccharide, can be conjugated to nOMVs according to the invention.
BE2017 / 5856
The conjugates of the invention are immunogenic, as demonstrated by studies in mice and supported by the experimental part included here.
As has been presented above, in another aspect, the invention relates to a process for the preparation of nOMV-linker-antigen conjugates, comprising reacting at least one nOMV protein residue with a first terminal part of a bivalent linker, this followed by a reaction of the second terminal part of such a linker with a selected foreign antigen, as described below in more detail.
Thus, according to one embodiment, the invention relates to a process for the preparation of nOMV-linker-antigen conjugates, comprising the following steps:
(i) reacting at least one protein on the surface of the nOMV with a bivalent linker to form an nOMV-linker intermediate; and (ii) reacting the nOMV-linker intermediate thus obtained with at least one foreign antigen to form the nOMV-linker-antigen conjugates of the invention.
According to one embodiment, the nOMVs are initially suspended in a correct buffer, such as MES buffer (2- (N-morpholino) ethanesulfonic acid), borate buffer or PBS (phosphate buffer solution), in order to select a pH of between 5 and 9, preferably 5 to 7 or 7 to 9, depending, for example, on the linker chosen or the conditions of the conjugation. The same pH ranges are also used for step ii) for the reaction between the free terminal end of the linker and the selected antigen as described below in detail.
BE2017 / 5856
After step i), the percentage of functionalization of nOMVs is between 15% and 60%, mainly depending on the type of bivalent linker used. In this regard, the% of functional groups relative to the free terminal end of the linker is from 15% to 40%, preferably from 30% to 35%, depending on the type and the stability of said reactive functional groups. It is in fact noted that such ranges allow the effectiveness of the process to be established, thereby resulting in a higher amount of the final antigen conjugate of the invention.
The buffered suspension thus obtained has a nOMV concentration of between 2 and 10 mg / ml, preferably 3 to 6 mg / ml. The chosen linker is generally added in amounts depending, for example, on —NH2 groups on the nOMVs, preferably in excess, even more preferably between 10 and 20 equivalents per mole of —NH2.
Depending on the linker, it may be practical to preventively solubilize it in a polar dry solvent, such as DMSO or the like, in order to facilitate handling and efficiency, thus obtaining improved results in terms of overall yield and reproducibility. .
The mixture is then incubated at room temperature (for example, from about 15 to 40 ° C) for a period of time generally from 30 minutes to 4 hours. Then, the intermediate nOMV-linker thus obtained is purified, for example, by ultracentrifugation, and then reacted with the antigen chosen according to step ii). The antigen is generally dissolved in
BE2017 / 5856 a correct buffer solution, such as a buffer solution, phosphate. The antigen is preferably added in an amount within the range of ratios of 2/1 to 1/2 w / w with respect to the nOMV-linker intermediate, or more preferably in a ratio of 1/1. The reaction can be monitored, for example, by HPLC / SEC and the formation of the final product can be confirmed by SDS page / Western blot analysis.
As an alternative embodiment, the conjugation reaction comprises the following steps: (i) reacting the antigen with a linker to form an antigen-linker intermediate; and (ii) reacting at least one protein on nOMV with the antigen-linker intermediate thus formed to form a nOMVlieur-antigen conjugate.
As another variant, the conjugation reaction comprises the following steps: (i) reacting the antigen with a first linker to form an antigen-linker intermediate; (ii) reacting at least one protein on nOMV with a second linker to form an nOMV-linker intermediate; and (iii) reacting ¹¹ antigen-linker with nOMV-linker to form a nOMV-linker-antigen conjugate.
Those skilled in the art will understand that when a homobifunctional linker is used, the functional groups of the protein and the antigen involved in the reaction will be the same chemical entity, as explained above in detail.
Thus, in a preferred embodiment, the method of the present invention comprises the following steps:
BE2017 / 5856 (i) reacting an -NH2 group of at least one nOMV protein with a bivalent homobifunctional linker to form an nOMV-linker intermediate; and (ii) reacting said intermediate with an -NH2 group on a foreign antigen chosen to form the nOMV-linker-antigen conjugate of the invention.
This type of conjugation reaction is illustrated in Scheme 2 below, using, for example, GMMA as the native vesicle and BS3 as the linker.
Diagram 2
When the linker reactions with the protein on the surface of the nOMV and the antigen involve different functional groups (such as an amine on the protein on the gallbladder and a thiol on the antigen, or vice versa), it is preferred to use a heterobifunctional linker of the general formula (I) above XL-X ', where X and X' are different from each other, as defined above, and L represents a group as defined above. Group X can react with a functional group, for example, an amine on the nOMV protein; while group X 'can react with a different functional group, for example, a
BE2017 / 5856 thiol on the selected antigen. Preferably, the group X represents an N-hydroxy-succinimide or a Noxysuccinimide, while the group X 'is chosen from at least one of: the 2-pyridyldithio, maleimide or iodoacetyl groups.
Alternatively, the conjugation method of the invention includes reacting the antigen with a first linker and a protein on the vesicle with a second linker, then reacting the first and second linkers together to form the conjugate.
For example, either the antigen or the protein on the nOMV can be reacted with a linker ending in a maleimide group, for example by reacting a primary amine or either the antigen or the protein on the nOMV with succinimidyl 4- (N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC) or N- (γ-maleimidobutyryloxy) succinimide ester (GMBS). A thiol on either the antigen or the protein on the nOMV can then be reacted with the maleimide. The thiol may be native to the protein on the nOMV or the antigen or the thiol may be the result of the reaction of the protein on the nOMV or the antigen with a separate linker. This type of conjugation reaction is illustrated in diagram 3 below, using, for example, a GMMA and fHbp as an antigen:
Diagram 3
BE2017 / 5856
Advantageously, thanks to its versatility, the invention can be used for the preparation of various conjugates, particularly appreciated by those skilled in the art when it has to face the problems of finding practical and reliable methodologies for obtaining immunogenic conjugates.
As another alternative, a protein on the vesicle can be linked to the antigen by (i) modifying the protein in the vesicle to include an alkyne; (ii) modification of the antigen to include an azide, then (iii) reaction of the alkyne and the azide, known as "click chemistry", as illustrated in Example 6. Alternatively, the the antigen can be modified to include an alkyne and the vesicle can be modified to include an azide. This type of conjugation reaction is illustrated in scheme 4 below, using, for example, a GMMÄ as a vesicle and fHbp as a ¹ antigen and using click chemistry devoid of copper.
The present invention is also useful for the preparation of nOMVs functionalized in various ways, allowing multivalent presentation of different antigens on the surface of the chosen vesicle.
BE2017 / 5856
Thus, according to a preferred embodiment,
The invention relates to an immunogenic conjugate comprising a nOMV as presented above, comprising at least one protein group connected to a first antigen by
The intermediary of a bivalent linker, where said first antigen is connected to one of the two chosen antigens (indicated here by Agi and
Ag2) can antigen connected be coupled
1-antigen 2 to the group together to give a nOMV surface protein derivative chosen by an appropriate bivalent linker as described above, to give a conjugate indicated by the formula nOMV-linker-Agl-Ag2 (I)
Alternatively, the nOMV protein residue can be first connected to the chosen Agl via a linker as described above, and then a second Ag2 is further connected to said Agi residue. , to give the conjugates of the general formula (I) above.
In all cases, the preferred nOMVs are the GMMA vesicles. The Agi and Ag2 in formula (I) can be chosen from the preferred antigens as described above, either protein or polysaccharide groups. Preferably, the antigens used for multi-functionalization as envisaged here are both proteins or both polysaccharides.
BE2017 / 5856
according to a other mode of production, the current invention himself reports at a conjugate immunogenic comprising a nOMV, including at least group
surface protein connected to a first antigen (Agi) by a bivale'nt linker, and at least one other surface protein group connected to a second different antigen (Ag2) by a bivalent linker, to give a conjugate indicated by the general formula (II):
Agl-linker-nOMV-linker-Ag2 (II)
As indicated in formula (II), Agi and Ag2 are each individually connected to nOMV by a bivalent linker. In this direction, the linker for the connection of the nOMV protein to Agl or Ag2 can be independently the same or differ from ^one another.
The conjugates of formula (II) can advantageously provide selective multi-functionalization of nOMVs, preferably GMMAs, using a specific functionalization profile. The Agi and Ag2 in formula (II) can be chosen from the preferred antigens as described above, either protein or polysaccharide groups. Preferably, the antigens used for multi-functionalization as envisaged here are both proteins or both polysaccharides.
Thus, according to a more preferred embodiment, the invention relates to a conjugate of formula (II) in which Agi comprises the capsular saccharide of Neisseria meningitidis of serogroup A
BE2017 / 5856 (MenA) and Ag2 comprises the capsular saccharide of Neisseria meningitidis of serogroup C (MenC), even more preferably having the nOMV which is a GMMA vesicle, more preferably obtained from Neisseria meningitidis of serogroup B, even more preferably expressing the v2 and v3 of fHbp.
Even more preferably, the two hours, each connecting Agi and Ag2, preferably of MenA and MenC respectively, are identical, more preferably SIDEA. In this regard, the multifunctionalized GMMA thus obtained can be used as an immunogenic agent against the Neisseria bacteria of MenB, MenA or MenC, as it is supported by the SBA data collected in this experimental part.
In one embodiment, said conjugates are prepared by a method comprising the addition of a mixture of activated polysaccharides of MenA and MenC to GMMA, according to the present procedure as described above. The polysaccharides of MenA and MenC are preferably activated by reaction with SIDEA, thus providing suitable SIDEA-MenA and SIDEA-MenC derivatives, capable of reacting with the -NH2 groups of the nOMV protein via the part terminal of the SIDEA group, thus leading to the conjugates of the general formula (II) above.
Western blot and HPAEC-PAD analysis confirms the formation of conjugates where MenA and MenC saccharides are randomly connected to GMMA surface proteins via the linker, and no aggregation of nOMV is detected by DDL.
BE2017 / 5856
Those skilled in the art will understand that in light of the versatility of the technology proposed, the present invention can be used in an appropriate manner for the multi-functionalization of nOMVs, preferably GMMAs, even with more than 2 different antigens. Apart from the possibility of choosing different antigens as indicated above, the present invention also allows the introduction of different quantities of different antigens, thus modulating the antigen / nOMV ratio according to, for example, the selected antigen or the nOMV used.
Thus, according to additional embodiments, the invention relates to conjugates of general formula (II) in which Agi comprises Hib and Ag2 comprises Hia, where said Agi and Ag2 are each individually conjugated to a GMMA, preferably a pertussic GMMA, even more preferably by a BS3 linker. In still other embodiments, the invention relates to conjugates of general formula (II) in which Agi comprises the ETEC 405 antigen (FdeC, SEQ ID NO: 16) and Ag2 comprises the 3526 antigen ETEC (SsIE, SEQ ID NO: 15), wherein said Agi and Ag2 are each independently conjugated to a GMMA, preferably a GMMA of Shigella sonnei, even more preferably by a BS3 linker.
According to another aspect, the invention relates to the conjugates of the invention for use as a medicament, particularly as an immunogenic agent, even more preferably for one or more of the pathogens as indicated here. In
BE2017 / 5856 in other words, the invention relates to the use of the present conjugates for the manufacture of an immunogenic composition.
According to another aspect, the invention relates to an immunogenic composition, preferably a vaccine, comprising a conjugate of the invention is at least one additional pharmaceutically acceptable carrier, excipient or adjuvant. Generally, the pharmaceutically acceptable carrier, excipient or adjuvant may be any substance which does not itself induce the production of antibodies which are harmful to the receiving patient.
the composition, and who can be administered. The supports and the excipients pharmaceutically acceptable are those used in 1 ' art, and they can understand of the liquids such as water, serum
physiological, glycerol and ethanol. Auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may also be present in such vehicles, according to the prior art.
The invention also provides a method for producing an immune response in a vertebrate, preferably a mammal, comprising administering a conjugate of the invention to the mammal or other vertebrate. The invention also provides conjugates of the invention for use in such methods. The immune response is preferably protective and preferably involves antibodies. The method may produce a callback response.
The mammal is preferably a human being. The subject in whom the disease is prevented may not
BE2017 / 5856 be the same as the subject receiving the conjugate of the invention. For example, a conjugate can be administered to a woman (before or during pregnancy) to protect her offspring (called "maternal immunization"). The conjugates of the invention can also be used to immunize other mammals, for example, cattle, sheep and pigs (especially against Salmonella sp.), And other non-mammalian vertebrates including fish and poultry .
The invention provides conjugates of the invention for use in therapy (for example, as immunogenic compositions or as vaccines). The invention also provides a conjugate of the invention for use in a method of producing an immune response in a vertebrate, preferably a mammal. The invention also provides the use of a conjugate of the invention in the manufacture of a medicament for producing an immune response in a vertebrate, preferably a mammal. The uses and methods are particularly useful for preventing / treating various diseases, depending on the antigens and nOMVs within the conjugates as presented above. The preferred conjugates of the invention can confer an antibody titer in a patient which is greater than the criterion for seroprotection for each antigenic component for an acceptable percentage of human subjects. Antigens with an associated antibody titer above which a host is considered to have undergone seroconversion against the antigen are well known, and such titles are published by
BE2017 / 5856 organizations such as WHO. Preferably more than 80% of a statistically significant sample of subjects has a seroconversion, more preferably more than 90%, still more preferably more than 93% and most preferably from 96 to 100%.
The immunogenic compositions of the invention will generally be administered directly to a patient. Direct administration can be accomplished by parenteral injection (e.g., subcutaneously, intraperitoneally, intravenously, intramuscularly, or into the interstitial space of tissue), or by rectal, oral, vaginal, topical, transdermal, intranasal administration , ocular, auricular, pulmonary or other mucosal. Intramuscular administration is preferred, for example, in the thigh or upper arm. The injection can be done using a needle (for example, a hypodermic needle), but an injection without a needle can be used as an alternative. The invention can also be used to trigger systemic and / or mucosal immunity. Dosage treatment can be a single dose schedule or a multiple dose schedule. Multiple doses can be used in a primary immunization schedule and / or in a booster immunization schedule. A primary dose schedule may be followed by a booster dose schedule. The appropriate time between sensitization doses (for example, between 4 to 16 weeks), and between sensitization and the booster, can be routinely determined.
BE2017 / 5856
Infections affect various areas of the body and thus the compositions of the invention can be prepared in various forms. For example, the compositions can be prepared in the form of injectables, either liquid solutions or suspensions. Solid forms suitable for solution, or suspension, in liquid vehicles prior to injection can also be prepared. The composition can be prepared for topical administration, for example, in the form of an ointment, a cream or a powder. The composition can be prepared for oral administration, for example, in the form of a tablet or capsule, or in the form of a syrup (optionally flavored). The composition can be prepared for pulmonary administration, for example, in the form of an inhaler, using a fine powder or a spray. The composition can be prepared in the form of a suppository or an ovum. The composition can be prepared for nasal, ear or eye administration, for example, in the form of drops. The compositions suitable for parenteral injection are most preferred. The composition is preferably sterile. It is preferably pyrogen-free. It is preferably buffered, for example, between pH 6 and pH 8, generally around pH 7. The compositions of the invention can be isotonic with respect to human beings. The immunogenic compositions comprise an immunologically effective amount of a conjugate of the invention, as well as any other specified component, as required. The treatment
BE2017 / 5856 dosage can be a single dose schedule or a multiple dose schedule (for example, including booster doses). The composition can be administered in conjunction with other immunoregulatory agents.
Adjuvants which may be optionally used in compositions of the invention include, but are not limited to, insoluble metal salts, oil-in-water emulsions (e.g., MF5 9 or AS03, both containing squalene), saponins, non-toxic LPS derivatives (such as monophosphoryl-lipid A or 3-O-deacylated MPL), immunostimulatory oligonucleotides, detoxified bacterial ADPribosylant toxins, microparticles, liposomes, imidazoquinolones, or their mixtures. Other substances which act as immunostimulatory agents are disclosed, for example, in Watson, Pediatr. Infect. Dis. J. (2000) 19: 331-332. The use of an adjuvant of aluminum hydroxide and / or aluminum phosphate is particularly preferred. These salts include oxyhydroxides and hydroxyphosphates. The salts can take any suitable form (for example, gel, crystalline, amorphous, etc.).
The conjugates of the invention which include nOMVs from one pathogen and a selected antigen from a second pathogen may be useful as immunogenic compounds for the preparation of multivalent vaccines.
The preferred nOMV-linker-antigen conjugates of the invention are shown in Table 1 below.
BE2017 / 5856
Table 1
Preferred Conjugates of the Invention
NOMVs linker Antigen Salmonella typhimurium BS3 Pfs25 fromPiasmodi um falciparum Salmonellatyphimurium BS (PEG) s Pfs25 fromPlasmodi um falciparum Salmonella typhimurium BS3 fHbp {Neisseria meningitidis) Salmonella typhimurium BS (PEG) s fHbp {Neisseria meningitidis) Salmonella typhimurium BS3 RO6C fromPlasmodium falciparum Salmonella typhimurium BS (PEG) 5 RO6C fromPlasmodium falciparum Salmonella typhimurium BS3 CSP ofPlasmodium falciparum Salmonella typhimurium BS (PEG) s CSP ofPlasmodium falciparum Bmeningococcal BS3 fHbp {Neisseria meningitidis) Bmeningococcal BS (PEG) 5 fHbp {Neisseria meningitidis)
BE2017 / 5856
Bmeningococcal BS3 NHBA {Neisseria meningitidis) Bmeningococcal BS (PEG) s NHBA {Neisseria meningitidis) Salmonella BS3 Synthetic PS or typhimurium native of GAS Salmonella typhimurium BS (PEG) s Synthetic PS ornative of GAS Salmonellatyphimurium BS3 Synthetic PS ornative of GBS Bmeningococcal BS3 Synthetic PS ornative of GAS Bmeningococcal BS3 Hib PS B. pertussis BS3 Hib PS Salmonella typhimurium BS3 PS of Vi Shigella BS3 ETEC 405 Shigella BS3 ETEC 3526 Shigella BS3 ETEC CTF1232 Bmeningococcal SIDEA MenA capsular saccharide Bmeningococcal SIDEA MenC capsular saccharide
Thus, the present conjugates are particularly useful as immunogens against the pathogens listed in Table 1. In particular, the data confirmed that the GMMAs from MenB
BE2017 / 5856 conjugated to capsular saccharides from MenA and / or MenC show r / hSBA results comparable to or even better than those obtained using CRM197 as a support protein. The SBA data in fact confirms the immunogenic response against MenA and MenC as well as against MenB (see in particular examples 12, 13 and 14).
This means that the present conjugates can be appropriately used for the preparation of an immunogenic composition, or a multivalent vaccine, for example, but not only, against MenB and MenC and / or MenA, as described herein and supported in detail.
The invention will now be described by the following experimental part, without placing any limitation on its scope.
Experimental part
Example 1 - Production of nOMVs
The nOMVs as used in the examples are GMMA vesicles, prepared from strains of S. typhimurium or N. meningitidis B, for example, as disclosed in Clin Vaccine Immunol. April 2016; 23 (4): 304-314. The characteristics of said nOMVs were as indicated in table 2 below.
Table 2
Characteristics of purified nOMVs prepared from strains of S. typhimurium or N. meningitidis B
BE2017 / 5856
S. typhimurium1418 (ûtolR) S. typhimurium2192 (AtolRApagP AmsbB) MenB(ûlAxLl, AsynX,Agna33 and ûfHbp) Diameter (nm) byDDL 131.5 112, 6 95, 6 nmol · of lipid A / mg of vesicles by HPLC-SEC / semicarbazide 172.8 243.2 68, 6 Weight reportOAG / proteinTotal 0.84 0.93 only the LOSpresent
Example 2 Conjugation of nOMVs via the linker BS3 (conjugation of Pfs25-nOMV of S. typhimurium ')
The malaria antigen Pfs25 was conjugated to the vesicles of nOMV of S. typhimurium following the procedure described below. The nOMVs, at a protein concentration of 4 mg / ml in 100 mM borate buffer pH 9, were added with Lieur BS3 (48 mg / ml in the reaction mixture). The mixture was incubated at a controlled temperature of 25 ° C for 30 minutes. After this time, the activated nOMVs were purified by ultracentrifugation (110,000 rpm, 16 min, 4 ° C.) and immediately added with the Pfs25 antigen. In the conjugation step, a ratio of 1/1 of nOMV / Pfs25 was used, at a concentration of Pfs25 of 2.7 mg / ml in PBS with overnight incubation at room temperature. The conjugate was purified by ultracentrifugation (110,000 rpm, 16 min, 4 ° C) and resuspended in PBS. Characterization by SDS analysis page /
BE2017 / 5856
Western blot confirmed the formation of the conjugate. Analysis by a competitive ELISA test showed a 19.2% w / w ratio of Pfs25 on total proteins in the final conjugate. The activated intermediate nOMVs were characterized by 62% of NH2 groups derivatized with the linker and 32% of active ester groups introduced onto the NH2 groups on the nOMVs. No crosslinking was verified in the two stages of activation of the nOMVs with BS3 and the following conjugation, verified by DDL.
EXAMPLE 3 v2 of fHbp linked to the nOMV of S. typhimurium by the chemistry of BS3 (recycling of fHbp)
The fHbp v2 antigen has been conjugated to S. typhimurium nOMVs by BS3 chemistry. The reaction was carried out by working with a w / w ratio of fHbp on nOMV-BS3 of 1, a v2 concentration of fHbp of 0.92 mg / ml in PBS. Another conjugate was produced by recycling unreacted fHbp v2 from the first conjugation batch and reusing it for conjugation with a fresh batch of nOMV-BS3, using the same conjugation conditions. SDS PAGE / Western blot analysis confirmed the formation of the conjugate also with the recycled fHbp v2.
Example 4 - CSP and (NANP) ₃ -SH linked to the nOMV of S, typhimurium by the chemistry of SH-maleimido according to 1 ¹ invention
Example 4.1 - Derivatization of CSP with the Ν-ε-maleimidocaproyl-oxysuccinimde ester linker (EMCS). The PSC at the concentration of 270 pg / ml in PBS was
BE2017 / 5856 added with the EMCS linker (in the form of a 10 mg / ml solution in DMSO) to have a molar ratio of 1/1 of the linker on the Lys residues of the protein. The solution was mixed at RT for 4 hours and then the derivatized protein was purified by a PD10 column against MES at 10 mM pH 6. The resulting product was characterized by a micro BCA test (64% recovery).
Example 4.2 - Derivatization of the nOMV of S. typhimurium with the linker SH.
NOMVs were resuspended in 100 mM borate buffer pH 8 and added with activation buffer containing 2.6 mg / ml of DTT, 13.16 mg / ml of EDTA and 7.04 mg / ml of linker N-acetyl-DL-homocysteine thiolactone in 100 mM borate buffer pH 11. The nOMVs were 2.3 mg / ml with a molar ratio of the linker to the NH ₂ groups on the GMMAs equal to 7. The nOMV-SHs were were purified by ultracentrifugation (110,000 rpm, 4 ° C, 1 hour) and recovered in 100 mM MES buffer pH 6. The nOMV-SHs were characterized by a micro BCA test (80% protein recovery) and TNBS showing that 54% of the NH ₂ groups have been activated.
Example 4.3 - Derivatization of the nOMV of S. typhimurium with the EMCS linker.
NOMVs were resuspended in 100 mM NaPi pH 7.2 and added with the EMCS linker (as a 20 mg / ml solution in DMSO) to have a molar ratio of 0.6 / 1 of linker on the Lys residues of the protein and with a nOMV concentration of 3.94 mg / ml. The reaction was allowed to mix at RT for 4 hours and the nOMV-EMCS were purified by
BE2017 / 5856 ultracentrifugation (110,000 rpm, 4 ° C, 1 hour). The derivatized nOMVs were recovered in 100 mM MES buffer pH 6. The nOMV-EMCS were characterized by a micro BCA test (87% protein recovery) and colorimetric methods with TNBS and Ellman to estimate the% of NH2 groups activated (30%).
Example 4.4 - Conjugation of nOMV-SH with the CSPEMC S.
The CSP protein, previously derivatized with the EMCS linker, has been conjugated to nOMV-SH. Conjugation was carried out with a w / w ratio of 1/1 of the nOMVs on the CSP at a CSP concentration of 96.7 gg / ml in 100 mM MES pH 6. The reaction was allowed to mix at RT for 4 hours and the conjugate was purified by ultracentrifugation (110,000 rpm, 4 ° C, 1 hour) and recovered in PBS. The amount of CSP conjugate relative to the total protein content was 0.33 (w / w) evaluated by HPLC-SEC analysis of the conjugation mixture. SDS PAGE / Western blot analysis confirmed the formation of the conjugate.
Example 4.5 - Conjugation of nOMV-EMCS with (NANP) 3-SH.
The protein (NANP) ₃ -SH, comprising a Cys terminal residue, was added to the nOMV-EMCS in MES at 100 mM pH 6 at a concentration of 8.7 mg / ml and with a w / w ratio of 1 per compared to nOMV. The reaction was allowed to mix at RT for 4 hours and the conjugate was purified by ultracentrifugation (110,000 rpm, 4 ° C, 1 hour) and collected in PBS. The amount of (NANP) 3 conjugate with respect to the total protein content was 0.31 (w / w) calculated by the Ellman analysis
BE2017 / 5856 and HPAEC-PAD on the conjugate. SDS PAGE / Western analysis confirmed the formation of the conjugate.
Example 5 Immunogenicity of the Conjugates of Example 4 in Mice
Mice were immunized subcutaneously on days 0 and 28 with the conjugates nOMV-CSP and nOMV (NANP) 3 prepared according to example 4. Compared to the physical mixture nOMV + CSP, with 2 μg of CSP or of ( NANP) 3 per dose. Anti-CSP IgG titers were measured on days 0, 14, 28 and 42, and the results are shown in Figure 1A.
The two nOMV conjugates induced a specific anti-CSP response greater than the CSP physically mixed with the nOMV (Kruskal-Wallis test with post-hoc Dunn analysis, p = 0.002 for nOMV-CSP and p = 0.001 for nOMV- (NANP) 3 respectively on day 42).
The two conjugates have shown the ability to stimulate the response (day 14 to day 42).
IgG titers against 1'-OAg were also estimated. The presence of CSP or (NANP) 3 on the surface of the nOMVs had no impact on the ability of the nOMVs to induce an anti-OAg IgG response (FIG. 1B).
Example 6 - vl.1 of fHbp linked to the nOMV of S. typhimurium by the chemistry of SH-maleimido or click
Example 6.1 - Derivatization of the nOMV of S. typhimurium with the linker ΞΗ.
NOMVs were suspended in 100 mM borate buffer pH 8 and added to the buffer
BE2017 / 5856 activation containing 2.6 mg / ml of DTT, 13.16 mg / ml of EDTA and 7.04 mg / ml of N-acetyl-DL-homocysteine thiolactone linker in 100 mM borate buffer pH 11 The nOMVs were at 3.0 mg / ml with a molar ratio of the linker over the NH 2 groups to the nOMVs equal to 6.63. The reaction was allowed to mix at RT for 4 hours and the nOMV-SH were then purified by dialysis against 50 mM MES buffer, 0.5 mM DTT pH 6. The nOMV-SH were characterized by the test Lowry (75% protein recovery) and TNBS showing that 41% of the NH2 groups were activated.
Example 6.2 - Derivatization of the vl. 1 of fHbp with the Ν-ε-maleimidocaproyl-oxysuccinimde ester linker (EMCS).
The fHbp at the concentration of 1.25 mg / ml in PBS was added with the EMCS linker (in the form of a solution at 10 mg / ml in DMSO) to have a molar ratio of 0.2 / 1 of the linker on the Lys residues of the protein. The solution was mixed at RT for
4.5 hours and then the derivatized protein was purified by a PD10 column against MES at 10 mM pH 6. The resulting product was characterized by a micro BCA test (95% recovery), HPLC-SEC analysis and SDSPAGE showing no protein aggregation compared to the non-derivatized protein and the MALDIMS analysis indicating an average of three linkers introduced per protein molecule.
Example 6.3 - Conjugation of nOMV-SH with fHbpEMCS.
FHbp-EMCS has been conjugated to nOMV-SH. Conjugation was performed with a w / w ratio of 2/1
BE2017 / 5856 of nOMVs on fHbp at a concentration of fHbp of 2 mg / ml. The reaction was allowed to mix at RT for 5 hours and the conjugate was purified by Vivaspin 100k against PBS. Conjugate formation was confirmed by SDS page / Western blot analysis.
Example 6 · 4 - Derivatization of the nOMV of S. typhimurium with the alkyne linker.
NOMVs were suspended in 100 mM NaPi pH 7.2 and added with the Click-Easy BCN ester of N-hydroxysuccinimide I (Berry Associates) at 25 mg / ml in DMSO. The nOMVs were 8.9 mg / ml with a molar ratio of the linker on the NH 2 groups on the GMMAs equal to 0.6. The reaction was allowed to mix at RT for 4 hours and the nOMV-alkyne was then purified by dialysis against 100 mM NaPi pH 7.2. The nOMV-alcyne were characterized by the Lowry test (72% protein recovery) and by TNBS showing that 40% of the NH2 groups were activated.
Example 6.5 - Derivatization of the vl. 1 of fHbp with the linker NHS-PEG4-N3.
The fHbp at the concentration of 1.25 mg / ml in PBS was added with the linker -N3 (in the form of a solution at 25 mg / ml in DMSO) to have a molar ratio of 0.2 / 1 of the linker on the Lys residues of the protein. The solution was mixed at RT for 6 hours and then the derivatized protein was purified by a PD10 column against 10 mM NaPi pH 7.2. The resulting product was characterized by a micro BCA test (87% recovery), an HPLCSEC and SDS-PAGE analysis, showing no aggregation of the protein compared to the non-derivatized protein, and
BE2017 / 5856 a MALDI-MS analysis, indicating an average of two linkers introduced per protein molecule.
Example 6.6 - Conjugation of nOMV-alcyne with fHbp-N3.
FHbp-N3 has been conjugated to nOMV-alcyne. Conjugation was performed with a 2: 1 w / w ratio of the nOMVs on fHbp at an fHbp concentration of 1.67 mg / ml. The reaction was allowed to mix at RT for 5 hours and the conjugate was purified by Vivaspin 100k against PBS. Conjugate formation was verified by SDS page / Western blot analysis.
Example 7 Immunogenicity of the Conjugates Obtained in Example 6 in Mice
Mice were immunized subcutaneously on days 0 and 28 with the conjugates synthesized compared to fHbp alone, nOMV alone and fHbp physically mixed with nOMV. 2.5 pg of total protein (1.75 pg of nOMV and 0.75 pg of fHbp, assuming a w / w ratio of fHbp to total protein in conjugates of 0.3) per dose were used. All antigens were formulated with Alhydrogel 0.7 mg / ml Al ³ + and 10 mM histidine.
The antibodies induced by the conjugates showed broad protection against different meningococcal strains, with higher bactericidal activity compared to recombinant fHbp alone or physically mixed with nOMVs (Table 3). Sera from the conjugates were also found to be bactericidal against the S. typhimurium strain of the invasive Malawian clinical isolate D23580 and not
BE2017 / 5856 lower than nOMV alone in terms of induced anti-OAg IgG response (Table 3).
Table 3
SBA titers against different meningococcal strains of pooled sera collected after immunization with fHbp constructs. The mice were immunized on days 0 and 28 with 2.5 μg of total protein (1.75 μg of nOMV and 0.75 μg of fHbp, assuming a w / w ratio of fHbp on the total proteins in the conjugates of 0.3) formulated with Alhydrogel.
Securities SBA versus s strains Niga16/09 Bufa20030020 Cam2_09 Mali4/11 B H44 / 76 BM6190 D23580fHbp ID 5 fHbp ID 9fHbp ID 1 STm serums J42 J42 J42 J42 JL4 142 J42 J42 NOMVs-SH-fHbp 32000 3600 2800 <10 1000 > 163840 >163840 66000 NOMVs-click-fHbp 40000 7000 600 <10 2800 > 163840 130000 17370 nOMV + fHbp 1800 <10 <10 <10 40 > 163840 10000 365732 fHbp 2500 <10 <10 <10 <10 > 163840 2000 <100 NOMVs <10 <10 <10 <10 <10 <10 <10 73309
Example 8 - MenB nOMV conjugated to the v3 protein of fHbp-SH by BS3 chemistry (no formation of aggregates after conjugation)
MenB nOMVs, at a protein concentration of 2.8 mg / ml in 100 mM MES buffer pH 6, were added to the BS3 linker (50 mg / ml in the reaction mixture). The mixture was incubated at a controlled temperature of 25 ° C for 30 minutes. After this time, the activated nOMVs were purified by ultracentrifugation (110,000 rpm, 16 min, 4 ° C.) and
BE2017 / 5856 immediately added with v3 of fHbp-SH. In the conjugation step, a w / w ratio of 1/1 of the nOMVs to fHbp-SH was used, with a concentration of nOMV of 1.7 mg / ml in PBS. After mixing overnight at RT, the conjugate was purified by ultracentrifugation (110,000 rpm, 16 min, 4 ° C) and recovered in PBS. Characterization by SDS page / Western blot confirmed the formation of the conjugate. NOMV-BS3 and the final conjugate were compared to native nOMV by HPLC-SEC / MALS showing no formation of aggregates (table below),
Sample Rw (nm) MenB nOMV 44.1 MENB-BS3 nOMV 58, 6 MenB-BS3-fHbp nOMV conjugate 54.0
Example 8a (comparative) - Conjugation of dOMV via the linker BS3
DOMVs (from MenB) were tested as starting material for the reaction with the linker BS3, under the following conditions:
- pH: 6.5;
- concentration of BS3: 50 mg / ml;
- concentration of dOMV: 1.011 mg / ml;
- reaction time of 30 min at 25 ° C;
- Purification by UC (110,000 rpm, 16 min, 4 ° C).
The reaction provides dOMV aggregates and side products as primary results.
BE2017 / 5856
The aggregation / crosslinking was verified by the DDL and SEC / MALS analysis.
Example 9 - nOMV of S. typhimurium conjugated to a PS of GAS
The PS of GAS was derivatized at its end with the ADH linker before conjugation to the nOMVs. The PS was solubilized in 20 mM AcONa pH 4.5 at 30 mg / ml and added with ADH and NaBHhCN both in a w / w ratio of 1/1 relative to the PS. The solution was mixed at 30 ° C for 5 days. After this time, the product was purified by 2 PD10 columns against 3 Na NaCl and water, respectively. PS-ADH was characterized by HPAEC-PAD (78% recovery) and TNBS, to discover that all of the PS chains were activated with the ADH linker.
NOMV, at a protein concentration of
4.4 mg / ml in 100 mM MES buffer pH 6 were added to the BS3 linker at 50 mg / ml in the reaction mixture. The mixture was incubated at a controlled temperature of 25 ° C for 30 minutes. After this time, the activated nOMVs were purified by ultracentrifugation (110,000 rpm, 16 min, 4 ° C.) and immediately added to the PS of GAS-ADH. In the conjugation step, a ratio of 1/3 of the nOMVs to the PS of GAS-ADH was used, with the concentration of PS of GAS-ADH of 10 mg / ml in ΡΒΞ. After overnight incubation at RT, the conjugate was purified by ultracentrifugation (110,000 rpm, 16 min, 4 ° C) and recovered in BBS. Characterization by a micro BCA test, an HPAEC-PAD and NTA analysis allowed
BE2017 / 5856 to estimate an average of 107 PS chains per nOMV particle.
The same conjugation protocol was applied to conjugate synthetic oligosaccharides of formula (Rha) 4- (CH2) 3-NH2 and (Rha) 6- (CH ₂ ) 3-NH2 to nOMV. The resulting conjugates showed an average number of 876 and 640 oligosaccharide chains per nOMV particle.
Example 10 - In vivo data of the conjugates of the invention obtained by conjugation of a nOMV particle of S. typhimurium to the antigens Pfs25 or v2 of fHbp by the chemistry of BS3
CD1 mice were immunized subcutaneously on days 0 and 28 with 2.5 μg of total proteins of nOMV particles of S. typhimurium conjugated to the Pfs25 or fHbp antigens by BS3 chemistry. All antigens were adsorbed on Alhydrogel (0.7 mg / ml Al ³⁺ ). The antiPfs25 (Figure 2) and anti-v2 IgG titers of fHbp (Figure 3) were measured on days 0, 14, 27 and 42.
As demonstrated, the nOMV-BS3 conjugates were able to induce a high specific anti-antigen IgG response.
Example 11 Preparation of MenA-GMMA-MenC Conjugates Via SIDEA Linkers
Meningococcal B GMMAs overexpressing fHbp, at a protein concentration of 10 mg / ml in 50 mM NaH ₂ PO4 buffer pH 7.2, were added simultaneously to saccharides of MenA and MenC (avDP 15), previously derivatized at their end with the SIDEA linker (Vaccine
BE2017 / 5856
1992 10 (10): 691-698), with a p / p ratio of MenA / MenC on nOMVs of 10/1, according to procedures known in the art. The mixture was incubated at room temperature overnight. After this time, the resulting conjugate was purified by ultracentrifugation (2x, 110,000 rpm, 1 h, 4 ° C) and suspended in PBS. Analysis by SDS PAGE / Western blot confirmed the formation of the conjugate, with the two saccharides linked to the nOMVs. The conjugate was characterized by a w / w ratio of MenA on the protein and a ratio of MenC on the protein of 0.10 and 0.12 respectively, determined by an HPAEC-PAD and micro BCA analysis, with 19.3%. of free saccharide of MenA and 4.3% of MenC respectively (by HPAEC-PAD analysis after treatment with C4 SPE of the conjugates).
Example 12 Preparation of MenA-GMMA Conjugates Via the SIDEA Linker
Meningococcal B GMMAs overexpressing fHbp, at a protein concentration of 10 mg / ml in 50 mM NaH2PO4 buffer pH 7.2, were added to the polysaccharide of MenA (avDP 15), previously derivatized at the end by the linker SIDEA (Vaccine 1992 10 (10): 691-698), with a w / w ratio of MenA on nOMVs of 10/1, according to procedures known in the art. The mixture was incubated at room temperature overnight. After this time, the resulting conjugate was purified by ultracentrifugation (2x, 110,000 rpm, 1 h, 4 ° C) and suspended in PBS. Analysis by SDS PAGE / Western blot confirmed the formation of the conjugate. The conjugate was characterized by a w / w ratio of MenA
BE2017 / 5856 on the 0.054 protein, determined by analysis
HPAEC-PAD and micro BCA, without no MenA free detected by HPAEC-PAD analysis after treatment by C4 SPE from conjugate. Example 13 - Preparation of the conjugates MenC-GMMA by through the linker S IDEA
The same procedure as that used in Example 12 was followed for the preparation of the title conjugate, using an antigen derived from MenC in place of MenA. The characterization of the conjugate is reported in the table below.
joint P / p ratioOS / GMMA Number of OSes per GMMA pg / mlback gg / mlfrom GMMA % of OSfree GMMA-MenA 0.054 2490 102.1 1901.6 Nodetected GMMA-MenC 0.1 4523 195, 1 1942.6 Nodetected MenC-GMMA-MenAbivalent 0.103 (MenA)0.12 (MenC) 3847(MenA)5168(MenC) 151.3 (MenA)176, 3 (MenC) 1468.2 4.3%free OSMenC,19.3%free OSMenA
Example 14 Immunogenicity Study in Mice
Female CD1 mice aged 5 to 6 weeks (8 per group) were immunized intramuscularly on days 0 and 28 with 1 μg of MenA or MenC per dose. GMMA conjugates were compared to conjugates
BE2017 / 5856
MenA-CRM197 or MenC-CRM197, and GMMA physically mixed with the polysaccharides of MenA or MenC.
All antigens were adsorbed on Alhydrogel (0.7 mg / ml Al ³⁺ ). The antiMenA and MenC IgG titers were measured on days -1, 27 and 42 (FIG. 2) and the SBA titers of the pooled sera from each group on day 42 were measured against a panel of MenA, MenC and MenB strains. .
EXAMPLE 14a Anti-MenA IgG / SBA
IgG response
As shown in FIG. 4, the immunogenicity study in mice has shown that:
- a higher anti-MenA IgG response is induced by the MenA-GMMA conjugate compared to MenA-CRMi97;
- the conjugation of MenA to GMMA amplifies the humoral immune response against the polysaccharide;
- the bivalent conjugate induces an anti-MenA IgG response comparable to the MenA-GMMA conjugate, without any interference due to the presence of MenC on the same GMMA particles.
SBA vs. MenA
Antigen jointMenA-GMMA Bivalent conjugate PS ofMenA +GMMA GMMA MenA-CRMi97 rSBAMenA strainF8238 262144 65536 1024 <16 8192
BE2017 / 5856
Example 14b Anti-MenC IgG / SBA
Conjugates tested in mice
IgG response
As shown in FIG. 5, the immunogenicity study in mice has shown that:
- a similar anti-MenC IgG response is induced by MenC-GMMA compared to MenC-CRMi9
- the conjugation of MenC to GMMA amplifies the humoral immune response against the OS
SBA vs. MenC
Antigen ConjugateMenA-GMMA Bivalent conjugate MenA PS+GMMA GMMA MenA-CRMi97 rSBAMenC strainEyelash 524288 262144 8192 4096 32768
Example 14c - anti-MenB SBA
SBA versus MenB for GMMA combined with MenA and / or
MenC
Antigen MenB strainUK 320 MenB strainUK 104 GMMA conjugateMenA 16384 32768 GMMA conjugateMenC 32768 16384 Bivalent conjugate 1024 1024 GMMA 131072 65536
BE2017 / 5856
MenA-CRM <16 <16 MenC-CRM <16 <16
The above data show that the conjugation of one or more antigens to the same GMMA according to the invention still provides a very good immunogenic profile of the antigens or of GMMA. This means that the present conjugates exhibit no interference from the antigens, confirming the potential use of the conjugates for the preparation of an immunogenic composition or a polyvalent vaccine against various pathogens.
BE2017 / 5856
Sequence list> SEQ ID NO: 1 [v2 of fHbp]
VAADIGAGLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKN DKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQIEKINNPDKIDSLINQRSFRVSGLGG EHTAFNQLPDGKAEYHGKAFSSDDAGGKLTYTIDFAAKQGHGKIEHLKTPEQNVELAAAELKA DEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQ> SEQ ID NO: 2 [NHBA]
MFKRSVIAMACIFALSACGGGGGGSPDVKSADTLSKPAAPWSEKETEAKEDAPQAGSQGQG
APSAQGSQDMAAVSEENTGNGGAVTADNPKNEDÈVAQNDMPQNAAGTDSSTPNHTPDPNM LAGNMENQATDAGESSQPANQPDMANAADGMQGDDPSAGGQNAGNTAAQGANQAGNNQA AGSSDPIPASNPAPANGGSNFGRVDLANGVLIDGPSQNITLTHCKGDSCSGNNFLDEEVQLKS EFEKLSDADKISNYKKDGKNDKFVGLVADSVQMKGINQYIIFYKPKPTSFARFRRSARSRRSLP AEMPLIPVNQADTLIVDGEAVSLTGHSGNIFAPEGNYRYLTYGAEKLPGGSYALRVQGEPAKGE MLAGAAVYNGEVLHFHTENGRPYPTRGRFAAKVDFGSKSVDGIIDSGDDLHMGTQKFKAAIDG NGFKGTWTENGSGDVSGKFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQD> SEQ ID NO: 3 [NadA]
MKHFPSKVLTTA1LATFCSGALAATSDDDVKKAATVAJVAAYNNGQEINGFKAGETIYDIGEDGTI
TQKDATAADVEADDFKGLGLKKVVTNLTKTVNENKQNVDAKVKAAESEIEKLTTKLADTDAALA
DTDAALDETTNALNKLGENITTFAEETKTNIVK1DEKLEAVADTVDKHAEAFNDIADSLDETNTKA DEAVKTANEAKQTAEETKQNVDAKVKAAETAAGKAEAAAGTANTAADKAEAVAAKVTDIKADIA TNKADIAKNSAR1DSLDKNVANLRKETRQGLAEQAALSGLFQPYNVGRFNVTAAVGGYKSESA VAIGTGFRFTENFAAKAGVAVGTSSGSSAAYHVGVNYEW> SEQ ID NO: 4 [NspA]
MKKALATLIALALPAAALAEGASGFYVQADAAHAKASSSLGSAKGFSPRISAGYRINDLRFAVDY TRYKNYKAPSTDFKLYSIGASAIYDFDTQSPVKPYLGARLSLNRASVDLGGSDSFSQTSIGLGVLYGGVLVGVVVVVVVVVVVVVGVVVVVVGVVVVVVGVVVVVVVVVVVVVV
MNKIYRIIWNSALNAWWVSELTRNHTKRASATVKTAVLATLLFATVQASANNEEQEEDLYLDP VQRTVAVLiVNSDKEGTGEKEKVEENSDWAVYFNEKGVLTAREITLKAGDNLKIKQNGTNFTYS LKKDLTDLTSVGTEKLSFSANGNKVN1TSDTKGLNFAKETAGTNGDTTVHLNGIGSTLTDTLLNT GATTNVTNDNVTDDEKKRAASVKDVLNAGWNIKGVKPGTTASDNVDFVRTYDTVEFLSADTKT TTVNVESKDNGKKTEVK1GAKTSVIKEKDGKLVTGKDKGENGSSTDEGEGLVTAKEVIDAVNKA GWRMKTTTANGQTGQADKFETVTSGTNVTFASGKGTTATVSKDDQGNITVMYDVNVGDALNV NQLQNSGWNLDSKAVAGSSGKVISGNVSPSKGKMDETVNINAGNNIEITRNGKNIDIATSMTPQ FSSVSLGAGADAPTLSVDGDALNVGSKKDNKPVRITNVAPGVKEGDVTNVAQLKGVAQNLNN RIDNVDGNARAGIAQAIATAGLVQAYLPGKSMMAIGGGTYRGEAGYAIGYSSISDGGNWIIKGT ASGNSRGHFGASASVGYQW
BE2017 / 5856> SEQ ID NO: 6 [App]
MKTTDKRTTETHRKAPKTGRIRFSPAYLAICLSFGILPQAWAGHTYFGINYQYYRDFAENKGKF AVGAKDIEVYNKKGELVGKSMTKAPMIDFSVVSRNGVAALVGDQYIVSVAHNGGYNNVDFGAE GRNPDQHRFTYKIVKRNNYKAGTKGHPYGGDYHMPRLHKFVTDAEPVEMTSYMDGRKWQN NYPDRVRIGAGRQYWRSDEDEPNNRESSYHIASAYSWLVGGNTFAQNGSGGGTVNLGSEKIK HSPYGFLPTGGSFGDSGSPMFIYDAQKQKWLINGVLQTGNPYIGKSNGFQLVRKDWFYDEIFA GDTHSVFYEPRQNGKYSFNDDNNGTGKINAKHEHNSLPNRLKTRTVQLFNVSLSETAREPVYH AAGGVNSYRPRLNNGENISFIDEGKGELILTSNINQGAGGLYFQGDFTVSPENNETWQGAGVH1 SEDSTVTWKVNGVANDRLSKIGKGTLHVQAKGENQGSISVGDGTV1LDQQADDKGKKQAFSEI GLVSGRGTVQLNADNQFNPDKLYFGFRGGRLDLNGHSLSFHRIQNTDEGAMIVNHNQDKEST VTITGNKDIATTGNNNSLDSKKEIAYNGWFGEKDTTKTNGRLNLVYQPAAEDRTLLLSGGTNLN GNITQTNGKLFFSGRPTPHAYNHLNDHWSQKEGIPRGEIVWDNDWINRTFKAENFQIKGGQAV
VSRNVAKVKGDWHLSNHAQAVFGVAPHQSHTICTRSDWTGLTNCVEKT1TDDKVIASLTKTDIS GNVDLADHAHLNLTGLATLNGNLSANGDTRYTVSHNATQNGNLSLVGNAQATFNQATLNGNT SASGNASFNLSDHAVQNGSLTLSGNAKANVSHSALNGNVSLADKAVFHFESSRFTGQISGGKD TALHLKDSEWTLPSGTELGNLNLDNATITLNSAYRHDAAGAQTGSATDAPRRRSRRSRRSLLS VTPPTSVESRFNTLTVNGKLNGQGTFRFMSELFGYRSDKLKLAESSEGTYTLAVNNTGNEPAS LEQLTWEGKDNKPLSENLNFTLQNEHVDAGAWRYQURKOGEFRLHNPVKEQELSDKLGKAE AKKQAEKDNAQSLDAUAAGRDAVEKTESVAEPARQAGGENVGIMQAEEEKKRVQADKDTALA KQREAETRPATTAFPRARRARRDLPQLQPQPQPQPQRDLISRYANSGLSEFSATLNSVFAVQD ELDRVFAEDRRNAVWTSGIRDTKHYRSQDFRAYRQQTDLRQ1GMQKNLGSGRVGILFSHNRT ENTFDDGIGNSARLAHGAVFGQYGIDRFYIGISAGAGFSSGSLSDGIGGKIRRRVLHYGIQARYR AGFGGFG1EPHIGATRYFVQKADYRYENVNIATPGLAFNRYRAGIKADYSFKPAQHISITPYLSLS YTDAASGKVRTRVNTAVLAQDFGKTRSAEWGVNAEiKGFTLSLHAAAAKGPOLEAQHSAGIKL GYRW> SEQ ID NO: 7 [fragment NadA]
ATNDDDVKKAATVAIAAAYNNGQEINGFKAGETIYDIDEDGTITKKDATAADVEADDFKGLGLKK
WTNLTKTVNENKQNVDAKVKAAESEIEKLTTKLADTDAALADTDAALDATTNALNKLGENITTF
AEETKTNIVKIDEKLEAVADTVDKHAEAFNDIADSLDETNTKADEAVKTANEAKQTAEETKQNVD
AKVKAAETAAGKAEAAAGTANTAADKAEAVAAKVTDIKADIATNKDNIAKKANSADVYTREESD SKFVRIDGLNATTEKLDTRLASAEKSIADHDTRLNGLDKTVSDLRKETRQGLAEQAALSGLFQP YNVG> SEQ ID NOH: 8p [v]
VAADIGAGL ADALTAPLDH KDKGLQSLTL DQSVRKNEKL KLAAQGAEKT YGNGDSLNTG KLKNDKVSRF DFIRQIEVDG QLITLESGEF QVYKQSHSAL TAFQTEQIQD SEHSGKMVAK RQFRIGDIAG EHTSFDKLPE GGRATYRGTA FGSDDAGGKL TYTIDFAAKQ GNGKIEHLKS PELNVDLAAA DIKPDGKRHA ViSGSVLYNQ AEKGSYSLGI FGGKAQEVAG SAEVKTVNGI RHIGLAAKQ> SEQ ID NO: 9 [v3 fHbp]
VAADIGTGLADALTAPLDHKDKGLKSLTLEDSIPQNGTLTLSAQGAEKTFKAGDKDNSLNTGKL KNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHSAVVALQIEKINNPDKTDSLINQRSFLVSGL GGEHTAFNQLPGGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTLEQNVELAAAEL KADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQ> SEQ ID NO: 10 [Pfs25]
BE2017 / 5856
KVTVDTVCKR GFLIQMSGHL ECKCENDLVL VNEETCEEKV LKCDEKTVNK PCGDFSKCIK IDGNPVSYAC KCNLGYDMVN NVCIPNECKQ VTCGNGKCIL DTSNPVKTGV CSCNIGKVPN VQDKKCKCQKCQKCQKCQKCQKCQKCQKCQKCQKCQKCQKCQKCQKQK
AERSTSENRNKRIGGPKLRGNVTSNIKFPSDNKGKIIRGSNDKLNKNSEDVLEQSEKSLVSENV PSGLDtDDIPKESIFIQEDQEGQTHSELNPETSEHSKDLNNNGSKNESSDIISENNKSNKVQNHF ESLSDLELLENSSQDNLDKDTISTEPFPNQKHKDLQQDLNDEPLEPFPTQIHKDYKEKNLINEED SEPFPRQKHKKVDNHNEEKNVFHENGSANGNQGSLKLKSFDEHLKDEKIENEPLVHENLSIPN DPIEQILNOPEQETNIQEQLYNEKQNVEEKQNSQIPSLDLKEPTNEDILPNHNPLENIKQSESEIN HVQDHALPKENliDKLDNQKEHIDQSQHNINVLQENNINNHQLEPQEKPNIESFEPKNIDSEIILPE NVETEEIIDDVPSPKHSNHETFEEETSESEHEEAVSEKNAHETVEHEETVSQESNPEKADNDG NVSQNSNNELNENEFVESEKSEHEARSKPKYEKKVIHGCNFSSNVSSKHTFTDSLDISLVDDSA HISCNVHLSEPKYNHLVGLNCPGDIIPDCFFQVYQPESEELEPSNIVYLDSQINIGDIEYYEDAEG DDKIKLFG1VGSIPKTTSFTCICKKDKKSAYMTVTIDSARSHHHHHH> SEQ ID NO: 12 [CPMP]
MLFQEYQCYGSSSNTRVLNELNYDNAGTNLYNELEMNYYGKQENWYSLKKNSRSLGENDDG NNNNGDNGREGKDEDKRDGNNEDNEKLRKPKHKKLKQPGDGNPDPNANPNVDPNANPNVD
PNANPNVDPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANP NANPNANPNVDPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPN
ANPNANPNANPNANPNANPNANPNANPNKNNQGNGQGHNMPNDPNRNVDENANANNAVKN NNNEEPSDKHIEKYLKKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYENDiEKKICK MEKCHHFHVHNHHH
NANPNANPNANP> SEQ ID NO: 14 [CTF1232]
QDQRYISIRNTDTiWLPGNICAYQFRLDNGGNDEGFGPLTITLQLKDKYGQTLVTRKMETEAFG DSNATRTTDAFLETECVENVATTEIIKATEESNGHRVSLPLSVFDPQDYHPLL1TVSGKNVNLEH HHHHs >Q: 26
BE2017 / 5856
DTPSVDSGSGTLPEVKPDPTPTPEPTPEPTPDPEPTPDPTPDPEPTPEPEPEPVPTKTGYLTLG GSQRVTGATCNGESSDGFTFTPGNTVSCVVGSTTIATFNTQSEAARSLRAVDKVSFSLEDAQE LANSENKKTNAISLVTSSDSCPADAEQLCLTFSSWDRARFEKLYKQIDLATDNFSKLVNEEVEN NAATDKAPSTHTSTVVPVTTEGTKPDLNASFVSANAEQFYQYQPTEIILSEGQLVDSLGNGVAG VDYYTNSGRGVTDENGKFSFSWGETISFGIDTFELGSVRGNKSTIALTELGDEVRGANIDQLIH RYSTTGQNNTRWPDDVRKVFAEYPNVINEIINLSLSNGATLDEGDQNWLPNEFIEQFKTGQA KEIDTAICAKTDGCNEARWFSLTTRNVNDGQIQGVINKLWGVDTNYQSVSKFHVFHDSTNFYG STGNARGQAVVNISNSAFPILMARNDKNYWLAFGEKRAWDKNELAYITEAPSIVQPENVT RDTATFNLPFISLGQVGEGKLMVIGNPHYNSILRCPNGYSWGGGVNSKGECTLSGDSDDM KHFMQNVLRYLSND1WQPNTKSIMTVGTNLENVYFKKAGQVLGNSAPFAFHEDFTGITVK QLTSYGDLNPEEIPLLILNGFEYVTQWSGDPYAVPLRADTSKPKLTQQDVTDLIAYLNKG GSVLIMENVMSNLKEESASSFVRLLDAAGLSMALNKSVVNNDPQGYPDRVRQRRATGIWV YERYPAADGAQPPYTIDPNTGEVTWKYQQDNKPDDKPKLEVASWQEEVEGKQVTRYAFID EAEYTTEESLEAAKAKIFEKFPGLQECKDSTYHYEINCLERRPGTDVPVTGGMYVPRYTQ LNLDADTAKAMVQAADLGTNIQRLYQHELYFRTKGSKGERLNSVDLERLYQNMSVWLWND TKYRYEEGKEDELGFKTFTEFLNCYANDAYAGGTKCSADLKKSLVDNNMIYGDGSSKAGM MNPSYPLNYMEKPLTRLMLGRSWWDLNIKVDVEKYPGSVSAKGESVTENISLYSNPTKWF AGNMQSTGLWAPAQQDVTIKSSASVPVTVTVALADDLTGREKHEVALNRPPRVTKTYTLE ANGEVTFKVPYGGLIYIKGDSKDDVSANFTFTGVVKAPFYKDGEWKNDLDSPAPLGELES ASFVYTTPKKNLEASNFTGGVAEFAKDLDTFASSMNDFYGRNDEDGKHRMFTYKNLTGHK HRFTNDVQISIGDAHSGYPVMNSSFSTNSTTLPTTPLNDWL1WHEVGHNAAETPLNVPGA TEVANNVLALYMQDRYLGKMNRVADDITVAPEYLDESNGQAWARGGAGDRLLMYAQLKEW AEENFDIKQWYPDGELPKFYSDRKGMKGWNLFQLMHRKARGDDVGNSTFGGKNYCAESNG NAADTLMLCASWVAQADLSEFFKKWNPGASAYQLPGATEMSFQGGVSSSAYSTLASLKLP KPEKGPETINKVTEHKMSAE> SEQ ID NO: 16 [405, Fdec]
VADGQQAYTLTLTAVDSEGNPVTGEASRLRLVPQDTNGVTVGAISEIKPGVYSATVSSTR AGNVWRAFSEQYQLGTLQQTLKFVAGPLDAAHSSITLNPDKPVVGGTVTAIWTAKDAND NPVTGLNPDAPSLSGAAAAGSTASGWTDNGDGTWTAQISLGTTAGELDVMPKLNGQDAAA NAAKVTVVADALSSNQSKVSVAEDHVKAGESTTVTLVAKDAHGNAISGLSLSASLTGTAS EGATVSSWTEKGDGSYVATLTTGGKTGELRVMPLFNGQPAATEAAQLTVIAGEMSSANST LVADNKTPTVKTTTELTFTMKDAYGNPVTGLKPDAPVFSGAASTGSERPSAGNWTEKGNG VYVSTLTLGSAAGQ LSVMPRVN N GO AVAQPLVLN VAGDASKAEIR DMTVKVN NQ

权利要求:
Claims (29)
[1]
1. Immunogenic conjugate comprising a native external membrane vesicle (nOMV) comprising at least one surface protein group connected to at least one antigen by a bivalent linker.
[2]
2. Immunogenic conjugate according to claim 1, comprising a nOMV comprising at least one surface protein group connected to a first antigen by a bivalent linker, wherein said first antigen is further connected to a second different antigen.
[3]
3. Immunogenic conjugate according to claim 1, comprising a nOMV comprising at least one surface protein group connected to a first antigen by a bivalent linker, and at least one other protein surface group connected to a second different antigen by a bivalent linker.
[4]
4. Immunogenic conjugate according to the preceding claims, in which said bivalent linker has the general formula (I):
X-L-X '(I) in which:
X and X 'are different from each other or identical, and represent a functional group capable of reacting selectively with the protein residue of the nOMVs on the one hand and with the antigen on the other hand;
-L- represents a linear or branched bivalent optionally substituted linear or branched C1 to C15 alkyl or alkenyl group,
BE2017 / 5856 and possibly interrupted by one or more heteroatoms chosen from: oxygen (—0—), sulfur (-S-), nitrogen (-NH- or a group -N- optionally substituted) and the like.
[5]
5. Immunogenic conjugate according to claim 4, in which the bivalent linker is a homobifunctional linker having X = X '.
[6]
6. Immunogenic conjugate according to claim 4, wherein said bivalent linker is chosen from at least one of: disuccinimidyl glutarate (DSG), disuccinimidyl suberate (DSS), 3— (2— pyridyldithio) propionate succinimidyl (SPDP), 6 (3- [2-pyridyldithio] -propionamido) succinimidyl hexanoate (LC-SPDP), 6- (3 '- (2-pyridyldithio) propionamido) sulfosuccinimidyl hexanoate (sulfo-LCSPDP), 4-succinimidyl-oxycarbonyl-a-methyl-oc- (2pyridyldithio) toluene (SMPT), 6- [a-methyl-a- (2pyridyldithio) toluenamido] sulfosuccinimidyl hexanoate (suifo-LC-SMPT), 4- Succinimidyl (Nmaleimidomethyl) cyclohexane-1-carboxylate (SMCC), sulfosuccinimidyl 4- (N-maleimidomethyl) cyclohexane-1-carboxylate (sulfoSMCC), m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), ester of m-maleimidobenzoyl-Nhydroxysulfosuccinimide (sulfo-MBS), N-succinimidyl (4iodoacetyl) aminobenzoate (SIAB), sulfosuccinimidyl (4-iodoacetyl) aminobenzoate e (sulfo-SIAB), 4- (N-maleimidophenyl) succinimidyl butyrate (SMPB), 4- (N-maleimidophenyl) sulfosuccinimidyl butyrate (suifo-SMPB), Ν-γmaleimidobutyryl-oxysuccinimide ester ), the ester of Ν-γ88
BE2017 / 5856 maleimidobutyryl-oxysulfosuccinimide (sulfo-GMBS), 6 - (((((4- (iodoacetyl) amino) methyl) cyclohexane-1carbonyl) amino) succinimidyl hexanoate (SIACX), 6 [6 - ((iodoacetyl ) amino) hexanoyl) amino] succinimidyl hexanoate (SIAXX), 4 - (((iodoacetyl) amino) methyl) cyclohexane-1-succinimidyl carboxylate (SIAC), 6- [(iodoacetyl) amino] succinimidyl hexanoate ( SIAX) and p-nitrophenyl iodoacetate (NPIA), N-hydroxysuccinimide, N-oxysuccinimide and the adipic acid N-hydroxysuccinimide diester (SIDEA) and bis (sulfosuccinimidyl) suberate (BS3), acryloyl halides (eg chloride), ethylene glycol bis [succinimidyl succinate], bis (suifosuccinimidyle) “tri (ethylene glycol) (BS (PEG) 3), bis (suifosuccinimidyle) tetra ( ethylene glycol) (BS (PEG) 4), bis (suifosuccinimidyle) -penta (ethylene glycol) (BS (PEG) 5) and bis (sulfosuccinimidyl) hexa (ethylene glycol) (BS (PEG) 6) adipic acid (AD H), the ß-propionamido group, nitrophenylethylamine, haloacyl halides, 6-aminocaproic acid.
[7]
7. The immunogenic conjugate according to claim 3, wherein said first antigen comprises Hib and said second antigen comprises Hia, wherein said first and second antigens are each individually conjugated to a pertussis GMMA vesicle by a BS3 linker.
[8]
8. The immunogenic conjugate of claim 3, wherein said first antigen comprises ETEC 405 antigen and said second antigen comprises ETEC 3526 antigen, wherein said first and second agents are
BE2017 / 5856 each individually conjugated to a GMMA vesicle of Shigella sonnei by a BS3 linker.
[9]
9. An immunogenic conjugate according to the preceding claims, wherein said nOMV is obtained by a detergent-free process, being released into the fermentation broth and purified using centrifugation and subsequent filtration; or being released into the fermentation broth and purified using two consecutive stages of tangential flow filtration (FFT).
[10]
10. Immunogenic conjugate according to the preceding claims, in which said nOMV is produced from wild type bacteria, or genetically modified bacterial strains which are mutated to amplify the production of vesicles, and possibly also to eliminate or modify antigens and / or to overexpress homologous antigens or antigens from other organisms.
[11]
11. Immunogenic conjugate according to the preceding claims, wherein said nOMV is obtained from a bacterium chosen from: Neisseria, Shigella, Salmonella enterica serovars, Haemophilus influenzae, Vibrio cholerae, Bordetella pertussis, Mycobacterium smegmatis, Mycobacterium bovis BCG, Escherichia coli, Bacteroides, Pseudomonas aeruginosa, Helicobacter pylori, Brucella melitensis Campylobacter jejuni, Actinobacillus actinomycetemcomitans, Xenorhabdus nematophilus,
Moraxella catarrhalis, or Borrelia burgdorferi.
BE2017 / 5856
[12]
12. Immunogenic conjugate according to claim 1,
in which said nOMV, the linker bivalent and antigen are chosen as follows: NOMVs linker AntigenPfs25 from Salmonella BS3 Plasmodium typhimuriumfalciparumPfs25 from SaImonella BS (PEG) s Plasmodium typhimuriumfalciparum Salmonella BS3 fHbp (Neisseria typhimurium meningitidis) SaImonella BS (PEG) s fHbp (Neisseria typhimurium meningitidis)RO6C from Salmonella typhimuri um BS3 Piasmodi um falciparumRO6C from Salmonella BS (PEG) s Piasmodi um typhimuriumfalciparumCSP of Salmonella typhimuri um BS3 Piasmodi um falciparumCSP of Salmonella BS (PEG) s Piasmodi um
typhimurium falciparum
B BS3 fHbp (Neisseria meningococcal meningitidis) BfHbp (Neisseria meningococcal BS (PEG) s meningitidis)
BE2017 / 5856
B BS3 NHBA {Neisseria meningococcalmeningitidis) B BS (PEG) 5 NHBA (Neisseria meningococcalmeningitidis) Salmonella BS3 Synthetic PS or typhimuriumnative of GAS Salmonella BS (PEG) s Synthetic PS or typhimuriumnative of GAS Sa Imonella BS3 Synthetic PS or typhimuriumnative of GBS B BS3 Synthetic PS or meningococcalnative of GAS BBS3 Hib PS meningococcal B. pertussis BS3 Hib PS SalmonellaBS3 'PS of Vi typhimurium Shigella BS3 ETEC 405 Shigella BS3 ETEC 3526 Shigella BS3 ETEC CTF1232saccharide BSIDEA capsular meningococcal MenAsaccharide B meningococcal SIDEA capsular MenC
[13]
13. The immunogenic conjugate according to claim 12, in which said nOMV, the divalent linker and the antigen are chosen as follows:
BE2017 / 5856
saccharide B SIDEA capsular meningococcalMenAsaccharide B SIDEA capsular meningococcalMenC
[14]
14. Immunogenic conjugate according to claim 3, comprising a nOMV comprising at least one surface protein group connected to a first antigen by a bivalent linker which is SIDEA, and at least one other surface protein group connected to a second different antigen by a bivalent linker which is SIDEA or BS3.
[15]
15. Immunogenic conjugate according to claim 3, comprising a nOMV comprising at least one surface protein group connected to a first antigen by a bivalent linker which is BS3, and at least one other surface protein group connected to a second different antigen by a bivalent binder which is BS3.
[16]
16. Immunogenic conjugate according to claims 3, 14 or 15, wherein said first antigen comprises an oligomer of Neisseria meningitidis of serogroup A (MenC), and said second antigen comprises an oligomer of Neisseria meningitidis of serogroup A (MenA).
[17]
17. The immunogenic conjugate according to claim 16, wherein said first antigen comprising a Neisseria meningitidis oligomer from serogroup C (MenC), and said second antigen comprising a Neisseria meningitidis oligomer from serogroup A (MenA) are
BE2017 / 5856 each individually connected to a nOMV by a SIDEA linker.
[18]
18. The immunogenic conjugate according to claims 1 to 17, wherein said nOMV is a GMMA vesicle.
[19]
19. Immunogenic conjugate according to claims 1 to 3 and 16 or 17, wherein said nOMV is a GMMA vesicle obtained from Neisseria meningitidis of serogroup B.
[20]
20. The immunogenic conjugate according to claim 19, wherein said nOMV is a GMMA vesicle obtained from Neisseria meningitidis of serogroup B, preferably expressing v2 and v3 of fHbp.
[21]
21. Process for the preparation of the immunogenic conjugate according to claims 1 to 20, comprising the following steps:
i) reacting at least one nOMV surface protein residue with the first terminal part of a bivalent linker to obtain a nOMV-linker intermediate; and ii) reacting said nOMV-linker intermediate with at least one antigen via the second terminal part of the bivalent linker, thereby obtaining the nOMV-linker-antigen conjugate.
[22]
22. Intermediate nOMV-linker obtained (or obtainable) by step i) according to claim 21.
[23]
23. Use of the nOMV-linker intermediate according to claim 22 for the preparation of the nOMV-linker antigen according to claims 1 to 20.
[24]
24. 'Immunogenic composition comprising a conjugate according to any one of Claims 1 to 20 and
BE2017 / 5856 minus a pharmaceutically acceptable carrier or excipient.
[25]
25. Conjugate or immunogenic composition according to any one of claims 1-20 or 24 for use as a medicament.
[26]
26. A conjugate or immunogenic composition for use according to claim 25 for inducing an immune response in a vertebrate.
[27]
27. A vaccine comprising the immunogenic conjugates according to claims 1 to 20 or the immunogenic composition according to claim 24.
[28]
28. Use of nOMV for the preparation of immunogenic conjugates.
[29]
29. Use of nOMV according to claim 28, wherein said immunogenic conjugates are as defined in any one of claims 1 to 20.

类似技术:

---

公开号 | 公开日 | 专利标题

---

BE1024465B1|2018-03-05|VACCINE

---

KR100628664B1|2006-09-27|Antigenic conjugates of conserved lipopolysaccharides of gram negative bacteria, and a vaccine formulation and a pharmaceutical composition comprising them

---

JP5555623B2|2014-07-23|Modified polysaccharides for conjugate vaccines

---

BE1025210B1|2018-12-12|IMMUNOGENIC CONJUGATES AND THEIR USE

---

BE1022878B1|2016-09-30|ANTI-MENINGOCOCCAL VACCINES

---

EA015551B1|2011-08-30|Conjugate vaccine

---

BE1022792A1|2016-09-06|MOLECULE SUPPORT

---

TW201808328A|2018-03-16|Multivalent pneumococcal polysaccharide-protein conjugate composition

---

BE1025443B1|2019-02-28|NOMV-ANTIGEN CONJUGATES AND THEIR USE

---

BE1024361B1|2018-02-05|IMMUNOGENIC COMPOSITION

---

KR20180121564A|2018-11-07|Novel polysaccharide-protein conjugates and methods for their preparation

---

EP2429658B1|2016-04-20|Method for adjuvating the lipopolysaccharide | of gram-negative bacteria

---

WO1997041888A1|1997-11-13|Immunogenic complex, use, method of preparation thereof and vaccine containing same

---

WO2010130899A1|2010-11-18|Meningococcal vaccine based on lipooligosaccharide | and neisseria meningitidis protein

---

US20220008529A1|2022-01-13|MULTI-FUNCTIONALIZED noMV CONJUGATES

---

CA2761924C|2017-10-31|Menigococcus vaccine containing lipooligosaccharide | from modified strains of l6 immunotype neisseria meningitidis

---

CN1288384A|2001-03-21|Lipooligosaccharide-based vaccine for prevention of i| i| i | infections in mammals

---

BE1024489A1|2018-03-07|VACCINE

---

FR2806913A1|2001-10-05|USE OF ALIPHATIC QUATERNARY AMMONIUMS AS ADJUVANT IN A MUCOSAL ADMINISTRATIVE PHARMACEUTICAL COMPOSITION

同族专利:

---

公开号 | 公开日

---

HUE052751T2|2021-05-28|

---

DK3544637T3|2021-01-18|

---

BR112019010625A2|2019-10-22|

---

JP2020500859A|2020-01-16|

---

CN110248681A|2019-09-17|

---

CA3044572A1|2018-05-31|

---

PL3544637T3|2021-06-14|

---

BE1025443A1|2019-02-21|

---

LT3544637T|2021-03-25|

---

HRP20210121T1|2021-03-05|

---

EP3544637A1|2019-10-02|

---

EP3544637B1|2020-11-11|

---

SI3544637T1|2021-02-26|

---

ES2847947T3|2021-08-04|

---

PT3544637T|2021-02-03|

---

MX2019006105A|2019-08-21|

---

WO2018096013A1|2018-05-31|

---

EP3799883A1|2021-04-07|

引用文献:

---

公开号 | 申请日 | 公开日 | 申请人 | 专利标题

---

EP0467714A1|1990-07-19|1992-01-22|Merck & Co. Inc.|The class II protein of the outer membrane of neisseria meningitidis|

---

WO2016083583A1|2014-11-28|2016-06-02|Crucell Holland B.V.|Meningitis b vaccine|

---

WO2016184860A1|2015-05-18|2016-11-24|Universita' Degli Studi Di Trento|Immunogenic compositions containing bacterial outer membrane vesicles and therapeutic uses thereof|

---

US4271147A|1980-01-10|1981-06-02|Behringwerke Aktiengesellschaft|Process for the isolation of membrane proteins from Neisseria meningitidis and vaccines containing same|

---

US4459286A|1983-01-31|1984-07-10|Merck & Co., Inc.|Coupled H. influenzae type B vaccine|

---

NZ214503A|1984-12-20|1990-02-26|Merck & Co Inc|Covalently-modified neutral bacterial polysaccharides, stable covalent conjugates of such polysaccharides and immunogenic proteins, and methods of preparing such polysaccharides and conjugates|

---

US4707543A|1985-09-17|1987-11-17|The United States Of America As Represented By The Secretary Of The Army|Process for the preparation of detoxified polysaccharide-outer membrane protein complexes, and their use as antibacterial vaccines|

---

NL8802046A|1988-08-18|1990-03-16|Gen Electric|POLYMER MIXTURE WITH POLYESTER AND ALKANE SULFONATE, OBJECTS THEREFORE.|

---

NZ581940A|1999-04-30|2011-07-29|Novartis Vaccines & Diagnostic|Conserved neisserial antigens|

---

KR100698561B1|2000-01-25|2007-03-21|더 유니버서티 어브 퀸슬랜드|Proteins comprising conserved regions of neisseria meningitidis surface antigen nhha|

---

WO2006124712A2|2005-05-16|2006-11-23|Merck & Co., Inc.|A method for improving the immunogenicity of plasmodium antigens|

---

US10279026B2|2012-04-26|2019-05-07|Glaxosmithkline Biologicals Sa|Antigens and antigen combinations|

---

AU2013265336A1|2012-05-22|2014-12-04|Novartis Ag|Meningococcus serogroup X conjugate|

---

EP2879700B1|2012-09-06|2017-06-07|EveliQure Biotechnologies GmbH|A novel live attenuated shigella vaccine|

---

AR102324A1|2014-07-17|2017-02-22|Glaxosmithkline Biologicals Sa|FHBP POLYPEPTIDES MODIFIED MENINGOCOCYCES|

---

CN110214022A|2016-11-25|2019-09-06|葛兰素史密丝克莱恩生物有限公司|Immunogenic conjugate and application thereof|CN110214022A|2016-11-25|2019-09-06|葛兰素史密丝克莱恩生物有限公司|Immunogenic conjugate and application thereof|

---

GB201712824D0|2017-08-10|2017-09-27|Glaxosmithkline Biologicals Sa|Multi-functionalized nOMV Conjugates|

法律状态:
2019-03-25| FG| Patent granted|Effective date: 20190228 |

优先权:

---

申请号 | 申请日 | 专利标题

---

GBGB1619949.9A|GB201619949D0|2016-11-25|2016-11-25|nOMV-antigen conjugated compounds and use thereof|

---

GB1619949.9|2016-11-25|

---

GBGB1712101.3A|GB201712101D0|2017-07-27|2017-07-27|nOMV-ANTIGEN CONJUGATES AND USE THEREOF|

---